![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC05g0921 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTCCTGTTGAGAATGAAGAAGAAGAGAGATCCTCTTTTGAACAGGAAAATTTGGTCACATAGATCCTTGATTTTGCCGGAATTCGTTGATAGCTCCGTACGAATTTACAATGGAAAAACTTCTGTTCATTGTAAGATCACTGAAGGAAGAGTTGGTCATAAATTTGGAGAGTTTGCTTCGACACGGAAACGAAGACTTTCGAGAACAAATATTGGACCG TTCCTGTTGAGAATGAAGAAGAAGAGAGATCCTCTTTTGAACAGGAAAATTTGGTCACATAGATCCTTGATTTTGCCGGAATTCGTTGATAGCTCCGTACGAATTTACAATGGAAAAACTTCTGTTCATTGTAAGATCACTGAAGGAAGAGTTGGTCATAAATTTGGAGAGTTTGCTTCGACACGGAAACGAAGACTTTCGAGAACAAATATTGGACCG TTCCTGTTGAGAATGAAGAAGAAGAGAGATCCTCTTTTGAACAGGAAAATTTGGTCACATAGATCCTTGATTTTGCCGGAATTCGTTGATAGCTCCGTACGAATTTACAATGGAAAAACTTCTGTTCATTGTAAGATCACTGAAGGAAGAGTTGGTCATAAATTTGGAGAGTTTGCTTCGACACGGAAACGAAGACTTTCGAGAACAAATATTGGACCG FLLRMKKKRDPLLNRKIWSHRSLILPEFVDSSVRIYNGKTSVHCKITEGRVGHKFGEFASTRKRRLSRTNIGP Homology
BLAST of MC05g0921 vs. ExPASy Swiss-Prot
Match: P27527 (Ribosomal protein S19, mitochondrial OS=Petunia hybrida OX=4102 GN=RPS19 PE=2 SV=2) HSP 1 Score: 125.2 bits (313), Expect = 3.1e-28 Identity = 62/73 (84.93%), Postives = 63/73 (86.30%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy Swiss-Prot
Match: P39697 (40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPS19 PE=1 SV=2) HSP 1 Score: 97.4 bits (241), Expect = 6.9e-20 Identity = 45/59 (76.27%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy Swiss-Prot
Match: P26874 (Ribosomal protein S19, mitochondrial OS=Marchantia polymorpha OX=3197 GN=RPS19 PE=3 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 4.5e-11 Identity = 33/48 (68.75%), Postives = 36/48 (75.00%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy Swiss-Prot
Match: P46750 (Ribosomal protein S19, mitochondrial OS=Prototheca wickerhamii OX=3111 GN=RPS19 PE=3 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.3e-10 Identity = 29/53 (54.72%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy Swiss-Prot
Match: A5FZW1 (30S ribosomal protein S19 OS=Acidiphilium cryptum (strain JF-5) OX=349163 GN=rpsS PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.2e-08 Identity = 26/47 (55.32%), Postives = 34/47 (72.34%), Query Frame = 0
BLAST of MC05g0921 vs. NCBI nr
Match: YP_009913640.1 (ribosomal protein S19 [Luffa acutangula] >YP_009913653.1 ribosomal protein S19 [Luffa acutangula] >QLJ93027.1 ribosomal protein S19 [Luffa acutangula] >QLJ93028.1 ribosomal protein S19 [Luffa acutangula]) HSP 1 Score: 142 bits (357), Expect = 3.98e-42 Identity = 70/73 (95.89%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC05g0921 vs. NCBI nr
Match: YP_003587230.1 (ribosomal protein S19 [Citrullus lanatus] >ACV96650.1 ribosomal protein S19 [Citrullus lanatus]) HSP 1 Score: 141 bits (356), Expect = 5.65e-42 Identity = 69/73 (94.52%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC05g0921 vs. NCBI nr
Match: YP_003587264.1 (ribosomal protein S19 [Citrullus lanatus] >ACV96651.1 ribosomal protein S19 [Citrullus lanatus]) HSP 1 Score: 137 bits (345), Expect = 2.69e-40 Identity = 68/73 (93.15%), Postives = 68/73 (93.15%), Query Frame = 0
BLAST of MC05g0921 vs. NCBI nr
Match: YP_003587380.1 (ribosomal protein S19 [Cucurbita pepo] >ACV96694.1 ribosomal protein S19 [Cucurbita pepo]) HSP 1 Score: 137 bits (345), Expect = 3.98e-40 Identity = 68/73 (93.15%), Postives = 68/73 (93.15%), Query Frame = 0
BLAST of MC05g0921 vs. NCBI nr
Match: YP_003587364.1 (ribosomal protein S19 [Cucurbita pepo] >ACV96693.1 ribosomal protein S19 [Cucurbita pepo]) HSP 1 Score: 137 bits (345), Expect = 4.50e-40 Identity = 68/73 (93.15%), Postives = 68/73 (93.15%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy TrEMBL
Match: A0A7D6C0E4 (Ribosomal protein S19 OS=Luffa acutangula OX=56866 GN=rps19-2 PE=3 SV=1) HSP 1 Score: 142 bits (357), Expect = 1.93e-42 Identity = 70/73 (95.89%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy TrEMBL
Match: D5I3A0 (Ribosomal protein S19 OS=Citrullus lanatus OX=3654 GN=rps19-1 PE=3 SV=1) HSP 1 Score: 141 bits (356), Expect = 2.74e-42 Identity = 69/73 (94.52%), Postives = 70/73 (95.89%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy TrEMBL
Match: D5I3D4 (Ribosomal protein S19 OS=Citrullus lanatus OX=3654 GN=rps19-2 PE=3 SV=1) HSP 1 Score: 137 bits (345), Expect = 1.30e-40 Identity = 68/73 (93.15%), Postives = 68/73 (93.15%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy TrEMBL
Match: D5I3G6 (Ribosomal protein S19 OS=Cucurbita pepo OX=3663 GN=rps19-2 PE=3 SV=1) HSP 1 Score: 137 bits (345), Expect = 1.93e-40 Identity = 68/73 (93.15%), Postives = 68/73 (93.15%), Query Frame = 0
BLAST of MC05g0921 vs. ExPASy TrEMBL
Match: D5I3F0 (Ribosomal protein S19 OS=Cucurbita pepo OX=3663 GN=rps19-1 PE=3 SV=1) HSP 1 Score: 137 bits (345), Expect = 2.18e-40 Identity = 68/73 (93.15%), Postives = 68/73 (93.15%), Query Frame = 0
BLAST of MC05g0921 vs. TAIR 10
Match: AT5G47320.1 (ribosomal protein S19 ) HSP 1 Score: 97.4 bits (241), Expect = 4.9e-21 Identity = 45/59 (76.27%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MC05g0921 vs. TAIR 10
Match: ATCG00820.1 (ribosomal protein S19 ) HSP 1 Score: 41.2 bits (95), Expect = 4.2e-04 Identity = 22/63 (34.92%), Postives = 35/63 (55.56%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|