![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC05g0852 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAGTCTCACCTTGGAAATGAAGGGAAGAAGCCATTTGCCGGTTCTTCTCATGCAAAAGGCATTGTTTTGGAAAAGATTGGTATTGAGGCTAAGCAGACAAATGATGGTATTGAAACAAAATTGCCGCATTTGTGCCTAATGAGATATATGGTTGTCTTAACCAAATTGAGGAGAATGATGAAGTATTGATTGCCGGATTCGGTCGTGAAGGACATGCCGTCGGAGACATTCCTGATGTTGGATTCAAGGTTGTCTCTCCTTGCACTTTTTAAGGAAAAGAAGGAGAAGCTAAGGTCT AAGTCTCACCTTGGAAATGAAGGGAAGAAGCCATTTGCCGGTTCTTCTCATGCAAAAGGCATTGTTTTGGAAAAGATTGGTATTGAGGCTAAGCAGACAAATGATGGTATTGAAAAAATTGCCGCATTTGTGCCTAATGAGATATATGGTTGTCTTAACCAAATTGAGGAGAATGATGAAGTATTGATTGCCGGATTCGGTCGTGAAGGACATGCCGTCGGAGACATTCCTGATGTTGGATTCAAGGTTGTCCTCCTTGCACTTTTTAAGGAAAAGAAGGAGAAGCTAAGGTCT AAGTCTCACCTTGGAAATGAAGGGAAGAAGCCATTTGCCGGTTCTTCTCATGCAAAAGGCATTGTTTTGGAAAAGATTGGTATTGAGGCTAAGCAGACAAATGATGGTATTGAAAAAATTGCCGCATTTGTGCCTAATGAGATATATGGTTGTCTTAACCAAATTGAGGAGAATGATGAAGTATTGATTGCCGGATTCGGTCGTGAAGGACATGCCGTCGGAGACATTCCTGATGTTGGATTCAAGGTTGTCCTCCTTGCACTTTTTAAGGAAAAGAAGGAGAAGCTAAGGTCT KSHLGNEGKKPFAGSSHAKGIVLEKIGIEAKQTNDGIEKIAAFVPNEIYGCLNQIEENDEVLIAGFGREGHAVGDIPDVGFKVVLLALFKEKKEKLRS Homology
BLAST of MC05g0852 vs. ExPASy Swiss-Prot
Match: P49201 (40S ribosomal protein S23-2 OS=Arabidopsis thaliana OX=3702 GN=RPS23B PE=2 SV=2) HSP 1 Score: 149.4 bits (376), Expect = 2.1e-35 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy Swiss-Prot
Match: Q9M5Z9 (40S ribosomal protein S23 OS=Euphorbia esula OX=3993 GN=RPS23 PE=2 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.1e-35 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy Swiss-Prot
Match: P46297 (40S ribosomal protein S23 OS=Fragaria ananassa OX=3747 GN=RPS23 PE=2 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.1e-35 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy Swiss-Prot
Match: Q9SF35 (40S ribosomal protein S23-1 OS=Arabidopsis thaliana OX=3702 GN=RPS23A PE=2 SV=2) HSP 1 Score: 141.0 bits (354), Expect = 7.3e-33 Identity = 82/116 (70.69%), Postives = 86/116 (74.14%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy Swiss-Prot
Match: Q86FP7 (40S ribosomal protein S23 OS=Dermacentor variabilis OX=34621 GN=RpS23 PE=2 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 8.4e-29 Identity = 72/117 (61.54%), Postives = 82/117 (70.09%), Query Frame = 0
BLAST of MC05g0852 vs. NCBI nr
Match: XP_022145774.1 (40S ribosomal protein S23-like [Momordica charantia]) HSP 1 Score: 161 bits (408), Expect = 9.42e-49 Identity = 89/116 (76.72%), Postives = 91/116 (78.45%), Query Frame = 0
BLAST of MC05g0852 vs. NCBI nr
Match: KCW49709.1 (hypothetical protein EUGRSUZ_K03211 [Eucalyptus grandis]) HSP 1 Score: 152 bits (383), Expect = 4.28e-45 Identity = 85/107 (79.44%), Postives = 87/107 (81.31%), Query Frame = 0
BLAST of MC05g0852 vs. NCBI nr
Match: ACF83276.1 (unknown [Zea mays] >KAG2618720.1 hypothetical protein PVAP13_3NG079762 [Panicum virgatum] >OEL15056.1 40S ribosomal protein S23 [Dichanthelium oligosanthes] >CAB3461235.1 unnamed protein product [Digitaria exilis] >ACL53616.1 unknown [Zea mays]) HSP 1 Score: 149 bits (375), Expect = 7.77e-44 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. NCBI nr
Match: GER49127.1 (40S ribosomal protein S23 [Striga asiatica]) HSP 1 Score: 149 bits (375), Expect = 7.77e-44 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. NCBI nr
Match: KAF7805552.1 (40S ribosomal protein S23 [Senna tora]) HSP 1 Score: 149 bits (375), Expect = 7.77e-44 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy TrEMBL
Match: A0A6J1CW97 (40S ribosomal protein S23-like OS=Momordica charantia OX=3673 GN=LOC111015149 PE=3 SV=1) HSP 1 Score: 161 bits (408), Expect = 4.56e-49 Identity = 89/116 (76.72%), Postives = 91/116 (78.45%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy TrEMBL
Match: A0A059A7J6 (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_K03211 PE=3 SV=1) HSP 1 Score: 152 bits (383), Expect = 2.07e-45 Identity = 85/107 (79.44%), Postives = 87/107 (81.31%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy TrEMBL
Match: A0A6A6L6X2 (Uncharacterized protein OS=Hevea brasiliensis OX=3981 GN=GH714_027795 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 3.76e-44 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy TrEMBL
Match: A0A151TV24 (40S ribosomal protein S23 OS=Cajanus cajan OX=3821 GN=KK1_010082 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 3.76e-44 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. ExPASy TrEMBL
Match: A0A072VW19 (40S ribosomal protein S23-1 OS=Medicago truncatula OX=3880 GN=25484043 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 3.76e-44 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. TAIR 10
Match: AT5G02960.1 (Ribosomal protein S12/S23 family protein ) HSP 1 Score: 149.4 bits (376), Expect = 1.5e-36 Identity = 85/116 (73.28%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of MC05g0852 vs. TAIR 10
Match: AT3G09680.1 (Ribosomal protein S12/S23 family protein ) HSP 1 Score: 141.0 bits (354), Expect = 5.2e-34 Identity = 82/116 (70.69%), Postives = 86/116 (74.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|