![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC05g0761 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTTAGTACTAAGAAGCAACCAAAAGGCAAGCCAGGGTTTATGGTGAAAGGTGCAACATTGGAGACTAATATTCCTATTCCATATGACGTTGTTAATGATCTCAAGGGTGGTTAC CTTAGTACTAAGAAGCAACCAAAAGGCAAGCCAGGGTTTATGGTGAAAGGTGCAACATTGGAGACTAATATTCCTATTCCATATGACGTTGTTAATGATCTCAAGGGTGGTTAC CTTAGTACTAAGAAGCAACCAAAAGGCAAGCCAGGGTTTATGGTGAAAGGTGCAACATTGGAGACTAATATTCCTATTCCATATGACGTTGTTAATGATCTCAAGGGTGGTTAC LSTKKQPKGKPGFMVKGATLETNIPIPYDVVNDLKGGY Homology
BLAST of MC05g0761 vs. ExPASy Swiss-Prot
Match: Q43291 (60S ribosomal protein L21-1 OS=Arabidopsis thaliana OX=3702 GN=RPL21A PE=2 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 2.3e-11 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of MC05g0761 vs. ExPASy Swiss-Prot
Match: Q9FDZ9 (60S ribosomal protein L21-2 OS=Arabidopsis thaliana OX=3702 GN=RPL21E PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 2.3e-11 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of MC05g0761 vs. NCBI nr
Match: XP_016680357.1 (60S ribosomal protein L21-1-like isoform X2 [Gossypium hirsutum] >KAB2034725.1 hypothetical protein ES319_D04G105200v1 [Gossypium barbadense] >KAG4151891.1 hypothetical protein ERO13_D04G090900v2 [Gossypium hirsutum] >TYH76857.1 hypothetical protein ES332_D04G114900v1 [Gossypium tomentosum] >TYI86990.1 hypothetical protein E1A91_D04G106100v1 [Gossypium mustelinum]) HSP 1 Score: 68.6 bits (166), Expect = 1.94e-13 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. NCBI nr
Match: TYG73568.1 (hypothetical protein ES288_D04G112500v1 [Gossypium darwinii]) HSP 1 Score: 68.6 bits (166), Expect = 1.94e-13 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. NCBI nr
Match: RWW67403.1 (hypothetical protein BHE74_00025158, partial [Ensete ventricosum]) HSP 1 Score: 67.0 bits (162), Expect = 2.31e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. NCBI nr
Match: XP_016680356.1 (60S ribosomal protein L21-1-like isoform X1 [Gossypium hirsutum] >KAB2034726.1 hypothetical protein ES319_D04G105200v1 [Gossypium barbadense] >KAG4151890.1 hypothetical protein ERO13_D04G090900v2 [Gossypium hirsutum] >TYI86989.1 hypothetical protein E1A91_D04G106100v1 [Gossypium mustelinum]) HSP 1 Score: 68.6 bits (166), Expect = 2.41e-13 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. NCBI nr
Match: TYG73569.1 (hypothetical protein ES288_D04G112500v1 [Gossypium darwinii]) HSP 1 Score: 68.6 bits (166), Expect = 2.41e-13 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. ExPASy TrEMBL
Match: A0A5D2LC30 (Uncharacterized protein OS=Gossypium tomentosum OX=34277 GN=ES332_D04G114900v1 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 9.41e-14 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. ExPASy TrEMBL
Match: A0A1U8IQH6 (60S ribosomal protein L21-1-like isoform X2 OS=Gossypium hirsutum OX=3635 GN=LOC107899215 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 9.41e-14 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. ExPASy TrEMBL
Match: A0A5J5RU01 (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=ES319_D04G105200v1 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 9.41e-14 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. ExPASy TrEMBL
Match: A0A5D2CXS3 (Uncharacterized protein OS=Gossypium darwinii OX=34276 GN=ES288_D04G112500v1 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 9.41e-14 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. ExPASy TrEMBL
Match: A0A5D2VDQ6 (Uncharacterized protein OS=Gossypium mustelinum OX=34275 GN=E1A91_D04G106100v1 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 9.41e-14 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of MC05g0761 vs. TAIR 10
Match: AT1G09590.1 (Translation protein SH3-like family protein ) HSP 1 Score: 68.2 bits (165), Expect = 1.7e-12 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of MC05g0761 vs. TAIR 10
Match: AT1G09690.1 (Translation protein SH3-like family protein ) HSP 1 Score: 68.2 bits (165), Expect = 1.7e-12 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of MC05g0761 vs. TAIR 10
Match: AT1G57660.1 (Translation protein SH3-like family protein ) HSP 1 Score: 68.2 bits (165), Expect = 1.7e-12 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of MC05g0761 vs. TAIR 10
Match: AT1G57860.1 (Translation protein SH3-like family protein ) HSP 1 Score: 68.2 bits (165), Expect = 1.7e-12 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|