
MC04g0417 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACGAAATATAGTAAATATTGTAAAGGCAAATGTAGTAGGGGTTGCAAACCAGACGGTACACAACTTGGTTTTGGAAGATATGACACTAAAAGTTGTAGAGCTGGTCGTCTTTCATATCGAGCCATTGAAGCAGCGCGTCGGGCTATAATCGGACAATTCCGAAGAAATGGTAAAATATGGGTAAGAGTTCTCGCGGATCTCCCTATTACCGGGAAACCTACAGAAGTCAGAATGGGAAGAGGAAAAGGAAATCCTACGGGTTGGATTGCTCATGTGTCCACGGGA ACGAAATATAGTAAATATTGTAAAGGCAAATGTAGTAGGGGTTGCAAACCAGACGGTACACAACTTGGTTTTGGAAGATATGACACTAAAAGTTGTAGAGCTGGTCGTCTTTCATATCGAGCCATTGAAGCAGCGCGTCGGGCTATAATCGGACAATTCCGAAGAAATGGTAAAATATGGGTAAGAGTTCTCGCGGATCTCCCTATTACCGGGAAACCTACAGAAGTCAGAATGGGAAGAGGAAAAGGAAATCCTACGGGTTGGATTGCTCATGTGTCCACGGGA ACGAAATATAGTAAATATTGTAAAGGCAAATGTAGTAGGGGTTGCAAACCAGACGGTACACAACTTGGTTTTGGAAGATATGACACTAAAAGTTGTAGAGCTGGTCGTCTTTCATATCGAGCCATTGAAGCAGCGCGTCGGGCTATAATCGGACAATTCCGAAGAAATGGTAAAATATGGGTAAGAGTTCTCGCGGATCTCCCTATTACCGGGAAACCTACAGAAGTCAGAATGGGAAGAGGAAAAGGAAATCCTACGGGTTGGATTGCTCATGTGTCCACGGGA TKYSKYCKGKCSRGCKPDGTQLGFGRYDTKSCRAGRLSYRAIEAARRAIIGQFRRNGKIWVRVLADLPITGKPTEVRMGRGKGNPTGWIAHVSTG Homology
BLAST of MC04g0417 vs. ExPASy Swiss-Prot
Match: Q04715 (60S ribosomal protein L16, mitochondrial OS=Petunia hybrida OX=4102 GN=RPL16 PE=2 SV=1) HSP 1 Score: 181.8 bits (460), Expect = 3.6e-45 Identity = 89/103 (86.41%), Postives = 91/103 (88.35%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy Swiss-Prot
Match: Q95747 (60S ribosomal protein L16, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL16 PE=1 SV=3) HSP 1 Score: 175.3 bits (443), Expect = 3.4e-43 Identity = 86/103 (83.50%), Postives = 89/103 (86.41%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy Swiss-Prot
Match: P46801 (60S ribosomal protein L16, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=RPL16 PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.3e-42 Identity = 86/103 (83.50%), Postives = 88/103 (85.44%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy Swiss-Prot
Match: P49389 (60S ribosomal protein L16, mitochondrial OS=Brassica napus OX=3708 GN=RPL16 PE=3 SV=2) HSP 1 Score: 169.5 bits (428), Expect = 1.9e-41 Identity = 84/103 (81.55%), Postives = 87/103 (84.47%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy Swiss-Prot
Match: P27927 (60S ribosomal protein L16, mitochondrial OS=Zea mays OX=4577 GN=RPL16 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 4.6e-40 Identity = 84/103 (81.55%), Postives = 86/103 (83.50%), Query Frame = 0
BLAST of MC04g0417 vs. NCBI nr
Match: YP_009745364.1 (ribosomal protein L16 [Salix paraflabellaris] >YP_009988226.1 ribosomal protein L16 [Salix cardiophylla] >YP_009988263.1 ribosomal protein L16 [Salix polaris] >QIH29810.1 ribosomal protein L16 [Salix paraflabellaris] >QNM38472.1 ribosomal protein L16 [Salix cardiophylla] >QNM38509.1 ribosomal protein L16 [Salix polaris]) HSP 1 Score: 184 bits (468), Expect = 4.66e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. NCBI nr
Match: YP_009230369.1 (ribosomal protein L16, partial [Salix suchowensis] >AMF83889.1 ribosomal protein L16, partial [Salix suchowensis]) HSP 1 Score: 184 bits (468), Expect = 4.66e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. NCBI nr
Match: YP_009239021.1 (ribosomal protein L16 [Salix purpurea] >AMO27206.1 ribosomal protein L16 [Salix purpurea]) HSP 1 Score: 184 bits (468), Expect = 4.66e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. NCBI nr
Match: YP_009560664.1 (ribosomal protein L16, partial [Populus alba] >QAA78963.1 ribosomal protein L16, partial [Populus alba]) HSP 1 Score: 184 bits (468), Expect = 4.97e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. NCBI nr
Match: YP_003587232.1 (ribosomal protein L16 [Citrullus lanatus] >ACV96644.1 ribosomal protein L16 [Citrullus lanatus]) HSP 1 Score: 184 bits (467), Expect = 6.63e-58 Identity = 88/95 (92.63%), Postives = 90/95 (94.74%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy TrEMBL
Match: A0A7G9ISX8 (Ribosomal protein L16 OS=Salix cardiophylla OX=688335 GN=rpl16 PE=3 SV=1) HSP 1 Score: 184 bits (468), Expect = 2.26e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy TrEMBL
Match: A0A109WWC5 (Ribosomal protein L16 (Fragment) OS=Salix suchowensis OX=1278906 GN=rpl16 PE=3 SV=1) HSP 1 Score: 184 bits (468), Expect = 2.26e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy TrEMBL
Match: A0A140HPA9 (Ribosomal protein L16 OS=Salix purpurea OX=77065 GN=rpl16 PE=3 SV=1) HSP 1 Score: 184 bits (468), Expect = 2.26e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy TrEMBL
Match: A0A7G9IT15 (Ribosomal protein L16 OS=Salix polaris OX=395315 GN=rpl16 PE=3 SV=1) HSP 1 Score: 184 bits (468), Expect = 2.26e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. ExPASy TrEMBL
Match: A0A451FPI4 (Ribosomal protein L16 (Fragment) OS=Populus alba OX=43335 GN=rpl16 PE=3 SV=1) HSP 1 Score: 184 bits (468), Expect = 2.41e-58 Identity = 88/95 (92.63%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of MC04g0417 vs. TAIR 10
Match: ATMG00080.1 (ribosomal protein L16 ) HSP 1 Score: 180.6 bits (457), Expect = 5.7e-46 Identity = 88/103 (85.44%), Postives = 91/103 (88.35%), Query Frame = 0
BLAST of MC04g0417 vs. TAIR 10
Match: ATCG00790.1 (ribosomal protein L16 ) HSP 1 Score: 82.0 bits (201), Expect = 2.8e-16 Identity = 40/95 (42.11%), Postives = 57/95 (60.00%), Query Frame = 0
BLAST of MC04g0417 vs. TAIR 10
Match: AT2G28830.1 (PLANT U-BOX 12 ) HSP 1 Score: 65.5 bits (158), Expect = 2.7e-11 Identity = 35/95 (36.84%), Postives = 51/95 (53.68%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|