MC03g0506 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTCCTCCTCCTTCTCCTCCCGGCGATGGTGGCCGCCGTCGCCGTGGCCGCCCGGAAGGGGCCTCTGGTCGGCGGCTGGACGCCGATTACGGACGTGAAGGATCCGCACGTTCAAGAGATCGGGAAGTTCGCGGTGGCGGCGTACAACACGCAATCGAAAGGAGCGATCAAATTCGATCGCGTGGAGAGCGGCGAAACGCAGGTGGTGTCCGGAACGAACTACCGGCTCGTGGTGGTGGCGAAGGACGGCGGCGGTTCGACGGCGAAGTACCAGGCGATCGTGTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACGTCTTTCAAGCCG CTCCTCCTCCTTCTCCTCCCGGCGATGGTGGCCGCCGTCGCCGTGGCCGCCCGGAAGGGGCCTCTGGTCGGCGGCTGGACGCCGATTACGGACGTGAAGGATCCGCACGTTCAAGAGATCGGGAAGTTCGCGGTGGCGGCGTACAACACGCAATCGAAAGGAGCGATCAAATTCGATCGCGTGGAGAGCGGCGAAACGCAGGTGGTGTCCGGAACGAACTACCGGCTCGTGGTGGTGGCGAAGGACGGCGGCGGTTCGACGGCGAAGTACCAGGCGATCGTGTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACGTCTTTCAAGCCG CTCCTCCTCCTTCTCCTCCCGGCGATGGTGGCCGCCGTCGCCGTGGCCGCCCGGAAGGGGCCTCTGGTCGGCGGCTGGACGCCGATTACGGACGTGAAGGATCCGCACGTTCAAGAGATCGGGAAGTTCGCGGTGGCGGCGTACAACACGCAATCGAAAGGAGCGATCAAATTCGATCGCGTGGAGAGCGGCGAAACGCAGGTGGTGTCCGGAACGAACTACCGGCTCGTGGTGGTGGCGAAGGACGGCGGCGGTTCGACGGCGAAGTACCAGGCGATCGTGTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACGTCTTTCAAGCCG LLLLLLPAMVAAVAVAARKGPLVGGWTPITDVKDPHVQEIGKFAVAAYNTQSKGAIKFDRVESGETQVVSGTNYRLVVVAKDGGGSTAKYQAIVWEKPWENFKKLTSFKP Homology
BLAST of MC03g0506 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 123.2 bits (308), Expect = 1.8e-27 Identity = 61/110 (55.45%), Postives = 78/110 (70.91%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 4.4e-26 Identity = 64/114 (56.14%), Postives = 79/114 (69.30%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 104.4 bits (259), Expect = 8.5e-22 Identity = 54/109 (49.54%), Postives = 74/109 (67.89%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.5e-21 Identity = 53/109 (48.62%), Postives = 72/109 (66.06%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy Swiss-Prot
Match: Q10Q47 (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.8e-17 Identity = 48/109 (44.04%), Postives = 67/109 (61.47%), Query Frame = 0
BLAST of MC03g0506 vs. NCBI nr
Match: XP_022142402.1 (cysteine proteinase inhibitor 5-like [Momordica charantia]) HSP 1 Score: 217 bits (552), Expect = 1.01e-70 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of MC03g0506 vs. NCBI nr
Match: XP_041025983.1 (LOW QUALITY PROTEIN: cysteine proteinase inhibitor 5 [Juglans microcarpa x Juglans regia]) HSP 1 Score: 145 bits (366), Expect = 1.59e-42 Identity = 70/95 (73.68%), Postives = 79/95 (83.16%), Query Frame = 0
BLAST of MC03g0506 vs. NCBI nr
Match: XP_018838679.1 (cysteine proteinase inhibitor 5 [Juglans regia]) HSP 1 Score: 144 bits (364), Expect = 3.31e-42 Identity = 70/97 (72.16%), Postives = 79/97 (81.44%), Query Frame = 0
BLAST of MC03g0506 vs. NCBI nr
Match: KAG7963107.1 (hypothetical protein I3843_09G102000 [Carya illinoinensis]) HSP 1 Score: 144 bits (363), Expect = 4.70e-42 Identity = 70/95 (73.68%), Postives = 77/95 (81.05%), Query Frame = 0
BLAST of MC03g0506 vs. NCBI nr
Match: XP_011654999.2 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 143 bits (361), Expect = 9.78e-42 Identity = 78/111 (70.27%), Postives = 90/111 (81.08%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy TrEMBL
Match: A0A6J1CMN4 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111012543 PE=4 SV=1) HSP 1 Score: 217 bits (552), Expect = 4.88e-71 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy TrEMBL
Match: A0A2I4G446 (cysteine proteinase inhibitor 5 OS=Juglans regia OX=51240 GN=LOC109004561 PE=4 SV=1) HSP 1 Score: 144 bits (364), Expect = 1.60e-42 Identity = 70/97 (72.16%), Postives = 79/97 (81.44%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy TrEMBL
Match: A0A0A0LTF5 (Cystatin-like protein OS=Cucumis sativus OX=3659 GN=Csa_1G183580 PE=4 SV=1) HSP 1 Score: 143 bits (361), Expect = 4.32e-42 Identity = 78/111 (70.27%), Postives = 90/111 (81.08%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy TrEMBL
Match: Q9FQ13 (Cystatin-like protein OS=Citrus paradisi OX=37656 PE=2 SV=1) HSP 1 Score: 141 bits (355), Expect = 3.88e-41 Identity = 70/109 (64.22%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MC03g0506 vs. ExPASy TrEMBL
Match: A0A067GFH2 (Cystatin domain-containing protein OS=Citrus sinensis OX=2711 GN=CISIN_1g033492mg PE=4 SV=1) HSP 1 Score: 141 bits (355), Expect = 3.88e-41 Identity = 70/109 (64.22%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MC03g0506 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 123.2 bits (308), Expect = 1.3e-28 Identity = 61/110 (55.45%), Postives = 78/110 (70.91%), Query Frame = 0
BLAST of MC03g0506 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 82.8 bits (203), Expect = 1.9e-16 Identity = 48/109 (44.04%), Postives = 64/109 (58.72%), Query Frame = 0
BLAST of MC03g0506 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 63.9 bits (154), Expect = 9.1e-11 Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|