MC02g0970 (gene) Bitter gourd (Dali-11) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTAATCAACCGACTTTATCGAGAAAGATTACTTTTTTTAGGCCAAGAGGTTGATAGCCAGATCTCGAATCAACTTATTGGTCTTATGGTATATCTCAGTATAGAGGATGATACCAAAGATCTGTATTTATTTATAAATCTAATCAACCGACTTTATCGAGAAAGATTACTTTTTTTAGGCCAAGAGGTTGATAGCCAGATCTCGAATCAACTTATTGGTCTTATGGTATATCTCAGTATAGAGGATGATACCAAAGATCTGTATTTATTTATAAAT CTAATCAACCGACTTTATCGAGAAAGATTACTTTTTTTAGGCCAAGAGGTTGATAGCCAGATCTCGAATCAACTTATTGGTCTTATGGTATATCTCAGTATAGAGGATGATACCAAAGATCTGTATTTATTTATAAAT LINRLYRERLLFLGQEVDSQISNQLIGLMVYLSIEDDTKDLYLFIN Homology
BLAST of MC02g0970 vs. ExPASy Swiss-Prot
Match: Q09WZ2 (ATP-dependent Clp protease proteolytic subunit OS=Morus indica OX=248361 GN=clpP PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.3e-16 Identity = 43/46 (93.48%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy Swiss-Prot
Match: Q9M3K5 (ATP-dependent Clp protease proteolytic subunit OS=Spinacia oleracea OX=3562 GN=clpP PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.3e-16 Identity = 43/44 (97.73%), Postives = 44/44 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy Swiss-Prot
Match: Q332V2 (ATP-dependent Clp protease proteolytic subunit OS=Lactuca sativa OX=4236 GN=clpP PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 1.7e-16 Identity = 42/46 (91.30%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy Swiss-Prot
Match: Q0G9J4 (ATP-dependent Clp protease proteolytic subunit OS=Liriodendron tulipifera OX=3415 GN=clpP PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 3.8e-16 Identity = 41/46 (89.13%), Postives = 45/46 (97.83%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy Swiss-Prot
Match: Q09FT6 (ATP-dependent Clp protease proteolytic subunit OS=Nandina domestica OX=41776 GN=clpP PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 3.8e-16 Identity = 42/44 (95.45%), Postives = 44/44 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. NCBI nr
Match: TAI92804.1 (ATP-dependent Clp protease proteolytic subunit, partial [Marinilabiliaceae bacterium JC017]) HSP 1 Score: 88.2 bits (217), Expect = 1.51e-21 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. NCBI nr
Match: NWD34190.1 (ATP-dependent Clp protease proteolytic subunit [Pseudomonas reactans]) HSP 1 Score: 87.8 bits (216), Expect = 4.33e-21 Identity = 44/46 (95.65%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. NCBI nr
Match: YP_009924569.1 (caseinolytic mitochondrial matrix peptidase proteolytic subunit [Styrax dasyanthus] >QNH68338.1 caseinolytic mitochondrial matrix peptidase proteolytic subunit [Styrax dasyanthus]) HSP 1 Score: 88.2 bits (217), Expect = 6.36e-21 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. NCBI nr
Match: RXV70727.1 (ATP-dependent Clp protease proteolytic subunit [bacterium 1XD8-92]) HSP 1 Score: 88.2 bits (217), Expect = 7.08e-21 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. NCBI nr
Match: KAF4348561.1 (hypothetical protein F8388_000240 [Cannabis sativa] >KAF4387292.1 hypothetical protein F8388_016701 [Cannabis sativa]) HSP 1 Score: 87.0 bits (214), Expect = 1.28e-20 Identity = 44/45 (97.78%), Postives = 45/45 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy TrEMBL
Match: A0A4Q8RL26 (ATP-dependent Clp protease proteolytic subunit (Fragment) OS=Marinilabiliaceae bacterium JC017 OX=2234116 GN=DMA11_25420 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 7.30e-22 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy TrEMBL
Match: A0A7G7WP61 (ATP-dependent Clp protease proteolytic subunit OS=Styrax dasyanthus OX=153530 GN=clpP PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.08e-21 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy TrEMBL
Match: A0A4Q2AMQ5 (ATP-dependent Clp protease proteolytic subunit OS=bacterium 1XD8-92 OX=2320884 GN=D6D47_47570 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.43e-21 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy TrEMBL
Match: A0A7J6DR23 (ATP-dependent Clp protease proteolytic subunit OS=Cannabis sativa OX=3483 GN=F8388_000240 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 6.20e-21 Identity = 44/45 (97.78%), Postives = 45/45 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. ExPASy TrEMBL
Match: A0A7M3US92 (ATP-dependent Clp protease proteolytic subunit OS=Osmanthus cooperi OX=424905 GN=clpP PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 9.94e-21 Identity = 44/46 (95.65%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC02g0970 vs. TAIR 10
Match: ATCG00670.1 (plastid-encoded CLP P ) HSP 1 Score: 77.8 bits (190), Expect = 2.5e-15 Identity = 38/46 (82.61%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MC02g0970 vs. TAIR 10
Match: AT1G12410.1 (CLP protease proteolytic subunit 2 ) HSP 1 Score: 52.8 bits (125), Expect = 8.7e-08 Identity = 20/44 (45.45%), Postives = 34/44 (77.27%), Query Frame = 0
BLAST of MC02g0970 vs. TAIR 10
Match: AT1G66670.1 (CLP protease proteolytic subunit 3 ) HSP 1 Score: 39.7 bits (91), Expect = 7.7e-04 Identity = 18/44 (40.91%), Postives = 29/44 (65.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|