
MC00g_new0371 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GAAAATAAAATGGACAACCAGAGGTATTACATATTAAACAGTGCAACTTGAAAAATTGCCAAAAGTATCCAATATCATAAAAATGGCTATAAGGCACCCGCGATGCATTGGCATTAGAAATCAAGATATTGGTATTGGACTTATCAATCGATTCATAACCTTTCAAACACAACCAATATATATTCGGACTCCCTTTACTTGTAGGAGTACATCTTGGATCTGCCGATTATGTTATGGACGAAGTCCTACTCACGGGGACCTGGTCGAATTGGGAGAAGCAGTAGGTATTATTGCGGGTCAATCTATTGGAGAACCGGGCACTCAACTAACATTAAGAACTTTTCATACCGGCGGAGTATTCACAGGGGGTACTGCAGAACATATACGAGCTCCTTCTAATGGAAAAATAAAATTCAATGAGGATTTGGTTCATCCCACACGTACACGTCATGTTAAAGTTCAATGCTATAATTTAATGTGGACAAATATACCCTCCAACCAAAATAGCTAAAATTATCCTACCATTACCCAAAAATTTTGTGTCAAAAATACTCTTGAAACAACTAT ATGGCTATAAGGCACCCGCGATGCATTGGCATTAGAAATCAAGATATTGGTATTGGACTTATCAATCGATTCATAACCTTTCAAACACAACCAATATATATTCGGACTCCCTTTACTTGTAGGAGTACATCTTGGATCTGCCGATTATGTTATGGACGAAGTCCTACTCACGGGGACCTGGTCGAATTGGGAGAAGCAGTAGGTATTATTGCGGGTCAATCTATTGGAGAACCGGGCACTCAACTAACATTAAGAACTTTTCATACCGGCGGAGTATTCACAGGGGGTACTGCAGAACATATACGAGCTCCTTCTAATGGAAAAATAAAATTCAATGAGGATTTGGTTCATCCCACACGTACACGTCATGTTAAAGTTCAATGCTATAATTTAATGTGGACAAATATACCCTCCAACCAAAATAGCTAA ATGGCTATAAGGCACCCGCGATGCATTGGCATTAGAAATCAAGATATTGGTATTGGACTTATCAATCGATTCATAACCTTTCAAACACAACCAATATATATTCGGACTCCCTTTACTTGTAGGAGTACATCTTGGATCTGCCGATTATGTTATGGACGAAGTCCTACTCACGGGGACCTGGTCGAATTGGGAGAAGCAGTAGGTATTATTGCGGGTCAATCTATTGGAGAACCGGGCACTCAACTAACATTAAGAACTTTTCATACCGGCGGAGTATTCACAGGGGGTACTGCAGAACATATACGAGCTCCTTCTAATGGAAAAATAAAATTCAATGAGGATTTGGTTCATCCCACACGTACACGTCATGTTAAAGTTCAATGCTATAATTTAATGTGGACAAATATACCCTCCAACCAAAATAGCTAA MAIRHPRCIGIRNQDIGIGLINRFITFQTQPIYIRTPFTCRSTSWICRLCYGRSPTHGDLVELGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGGTAEHIRAPSNGKIKFNEDLVHPTRTRHVKVQCYNLMWTNIPSNQNS Homology
BLAST of MC00g_new0371 vs. ExPASy Swiss-Prot
Match: Q4VZP3 (DNA-directed RNA polymerase subunit beta'' OS=Cucumis sativus OX=3659 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 250.8 bits (639), Expect = 9.5e-66 Identity = 120/135 (88.89%), Postives = 123/135 (91.11%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy Swiss-Prot
Match: A8SE78 (DNA-directed RNA polymerase subunit beta'' OS=Ceratophyllum demersum OX=4428 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 246.5 bits (628), Expect = 1.8e-64 Identity = 117/135 (86.67%), Postives = 121/135 (89.63%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy Swiss-Prot
Match: Q49L08 (DNA-directed RNA polymerase subunit beta'' OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 244.6 bits (623), Expect = 6.8e-64 Identity = 112/118 (94.92%), Postives = 116/118 (98.31%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy Swiss-Prot
Match: Q09X27 (DNA-directed RNA polymerase subunit beta'' OS=Morus indica OX=248361 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 242.7 bits (618), Expect = 2.6e-63 Identity = 111/117 (94.87%), Postives = 115/117 (98.29%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy Swiss-Prot
Match: Q8S8Y1 (DNA-directed RNA polymerase subunit beta'' OS=Atropa belladonna OX=33113 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 4.4e-63 Identity = 111/118 (94.07%), Postives = 114/118 (96.61%), Query Frame = 0
BLAST of MC00g_new0371 vs. NCBI nr
Match: CAP11908.1 (RNA polymerase beta subunit, partial [Begonia conchifolia]) HSP 1 Score: 242 bits (617), Expect = 1.33e-79 Identity = 117/135 (86.67%), Postives = 122/135 (90.37%), Query Frame = 0
BLAST of MC00g_new0371 vs. NCBI nr
Match: CAP11909.1 (RNA polymerase beta subunit, partial [Begonia plagioneura]) HSP 1 Score: 241 bits (615), Expect = 2.69e-79 Identity = 114/117 (97.44%), Postives = 116/117 (99.15%), Query Frame = 0
BLAST of MC00g_new0371 vs. NCBI nr
Match: CAP11921.1 (RNA polymerase beta subunit, partial [Sophora toromiro]) HSP 1 Score: 240 bits (612), Expect = 6.08e-78 Identity = 112/117 (95.73%), Postives = 115/117 (98.29%), Query Frame = 0
BLAST of MC00g_new0371 vs. NCBI nr
Match: CAP11920.1 (RNA polymerase beta subunit, partial [Sophora microphylla]) HSP 1 Score: 240 bits (612), Expect = 6.08e-78 Identity = 112/117 (95.73%), Postives = 115/117 (98.29%), Query Frame = 0
BLAST of MC00g_new0371 vs. NCBI nr
Match: CAP11904.1 (RNA polymerase beta subunit, partial [Acorus calamus] >CAP11905.1 RNA polymerase beta subunit, partial [Acorus gramineus]) HSP 1 Score: 236 bits (602), Expect = 2.75e-77 Identity = 108/117 (92.31%), Postives = 114/117 (97.44%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy TrEMBL
Match: B0BEF6 (DNA-directed RNA polymerase (Fragment) OS=Begonia conchifolia OX=212713 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 242 bits (617), Expect = 6.45e-80 Identity = 117/135 (86.67%), Postives = 122/135 (90.37%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy TrEMBL
Match: B0BEF7 (DNA-directed RNA polymerase (Fragment) OS=Begonia plagioneura OX=476164 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 241 bits (615), Expect = 1.30e-79 Identity = 114/117 (97.44%), Postives = 116/117 (99.15%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy TrEMBL
Match: B0BEG8 (DNA-directed RNA polymerase (Fragment) OS=Sophora microphylla OX=70607 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 240 bits (612), Expect = 2.94e-78 Identity = 112/117 (95.73%), Postives = 115/117 (98.29%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy TrEMBL
Match: B0BEG9 (DNA-directed RNA polymerase (Fragment) OS=Sophora toromiro OX=85268 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 240 bits (612), Expect = 2.94e-78 Identity = 112/117 (95.73%), Postives = 115/117 (98.29%), Query Frame = 0
BLAST of MC00g_new0371 vs. ExPASy TrEMBL
Match: B0BEF2 (DNA-directed RNA polymerase (Fragment) OS=Acorus calamus OX=4465 GN=rpoC2 PE=4 SV=1) HSP 1 Score: 236 bits (602), Expect = 1.33e-77 Identity = 108/117 (92.31%), Postives = 114/117 (97.44%), Query Frame = 0
BLAST of MC00g_new0371 vs. TAIR 10
Match: ATCG00170.1 (DNA-directed RNA polymerase family protein ) HSP 1 Score: 231.1 bits (588), Expect = 5.5e-61 Identity = 106/117 (90.60%), Postives = 110/117 (94.02%), Query Frame = 0
BLAST of MC00g_new0371 vs. TAIR 10
Match: AT5G60040.1 (nuclear RNA polymerase C1 ) HSP 1 Score: 49.3 bits (116), Expect = 3.0e-06 Identity = 21/32 (65.62%), Postives = 25/32 (78.12%), Query Frame = 0
BLAST of MC00g_new0371 vs. TAIR 10
Match: AT5G60040.2 (nuclear RNA polymerase C1 ) HSP 1 Score: 49.3 bits (116), Expect = 3.0e-06 Identity = 21/32 (65.62%), Postives = 25/32 (78.12%), Query Frame = 0
BLAST of MC00g_new0371 vs. TAIR 10
Match: AT3G57660.1 (nuclear RNA polymerase A1 ) HSP 1 Score: 47.4 bits (111), Expect = 1.1e-05 Identity = 20/39 (51.28%), Postives = 26/39 (66.67%), Query Frame = 0
BLAST of MC00g_new0371 vs. TAIR 10
Match: AT4G35800.1 (RNA polymerase II large subunit ) HSP 1 Score: 46.6 bits (109), Expect = 1.9e-05 Identity = 21/33 (63.64%), Postives = 24/33 (72.73%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|