Lsi11G011560 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTCCGTTTGATAAACAGCCCAAGGAAAACATCATCGACTGTTCCAAAGGGGTTTTTCGCTGTCTACGTTGGAGAAACCCAAAAGAGACGACATGTGATTCCGATTTCTTACTTGAAGCATCCATCGTTTCAAGATTTGTTGAGTAAAGCTGAAGAAGAGTTTGGATTCGATCATCCAATGGGGGGCTTGACGATCCCTTGCAATGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCTAATTGTTGA ATGGGATTCCGTTTGATAAACAGCCCAAGGAAAACATCATCGACTGTTCCAAAGGGGTTTTTCGCTGTCTACGTTGGAGAAACCCAAAAGAGACGACATGTGATTCCGATTTCTTACTTGAAGCATCCATCGTTTCAAGATTTGTTGAGTAAAGCTGAAGAAGAGTTTGGATTCGATCATCCAATGGGGGGCTTGACGATCCCTTGCAATGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCTAATTGTTGA ATGGGATTCCGTTTGATAAACAGCCCAAGGAAAACATCATCGACTGTTCCAAAGGGGTTTTTCGCTGTCTACGTTGGAGAAACCCAAAAGAGACGACATGTGATTCCGATTTCTTACTTGAAGCATCCATCGTTTCAAGATTTGTTGAGTAAAGCTGAAGAAGAGTTTGGATTCGATCATCCAATGGGGGGCTTGACGATCCCTTGCAATGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCTAATTGTTGA MGFRLINSPRKTSSTVPKGFFAVYVGETQKRRHVIPISYLKHPSFQDLLSKAEEEFGFDHPMGGLTIPCNEDVFFEVTSRLANC Homology
BLAST of Lsi11G011560 vs. ExPASy Swiss-Prot
Match: Q9FJF9 (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana OX=3702 GN=SAUR21 PE=2 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.1e-26 Identity = 53/72 (73.61%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy Swiss-Prot
Match: Q9FK62 (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana OX=3702 GN=SAUR24 PE=2 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 7.4e-26 Identity = 51/78 (65.38%), Postives = 62/78 (79.49%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy Swiss-Prot
Match: Q9FJG0 (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana OX=3702 GN=SAUR20 PE=1 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 9.7e-26 Identity = 51/77 (66.23%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy Swiss-Prot
Match: Q9FJF7 (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana OX=3702 GN=SAUR22 PE=2 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.3e-25 Identity = 50/78 (64.10%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy Swiss-Prot
Match: Q9FJF6 (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana OX=3702 GN=SAUR23 PE=2 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.2e-25 Identity = 51/78 (65.38%), Postives = 62/78 (79.49%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy TrEMBL
Match: A0A0A0K4I7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008440 PE=3 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 5.0e-41 Identity = 82/84 (97.62%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy TrEMBL
Match: A0A6J1HY12 (auxin-responsive protein SAUR21-like OS=Cucurbita maxima OX=3661 GN=LOC111468496 PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 2.5e-40 Identity = 83/85 (97.65%), Postives = 84/85 (98.82%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy TrEMBL
Match: A0A6J1GL96 (auxin-responsive protein SAUR21-like OS=Cucurbita moschata OX=3662 GN=LOC111454990 PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 2.5e-40 Identity = 83/85 (97.65%), Postives = 84/85 (98.82%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy TrEMBL
Match: A0A6J1C3M2 (auxin-responsive protein SAUR21-like OS=Momordica charantia OX=3673 GN=LOC111007637 PE=3 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 3.2e-40 Identity = 81/83 (97.59%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Lsi11G011560 vs. ExPASy TrEMBL
Match: A0A5D3CP52 (Auxin-responsive protein SAUR21-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold106G001290 PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 7.2e-40 Identity = 80/84 (95.24%), Postives = 82/84 (97.62%), Query Frame = 0
BLAST of Lsi11G011560 vs. NCBI nr
Match: XP_011658572.1 (auxin-responsive protein SAUR21 [Cucumis sativus] >KGN43197.1 hypothetical protein Csa_020466 [Cucumis sativus]) HSP 1 Score: 176.4 bits (446), Expect = 1.0e-40 Identity = 82/84 (97.62%), Postives = 83/84 (98.81%), Query Frame = 0
BLAST of Lsi11G011560 vs. NCBI nr
Match: XP_022952260.1 (auxin-responsive protein SAUR21-like [Cucurbita moschata] >XP_022969521.1 auxin-responsive protein SAUR21-like [Cucurbita maxima] >XP_023554332.1 auxin-responsive protein SAUR21-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 174.1 bits (440), Expect = 5.1e-40 Identity = 83/85 (97.65%), Postives = 84/85 (98.82%), Query Frame = 0
BLAST of Lsi11G011560 vs. NCBI nr
Match: XP_022135747.1 (auxin-responsive protein SAUR21-like [Momordica charantia]) HSP 1 Score: 173.7 bits (439), Expect = 6.7e-40 Identity = 81/83 (97.59%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Lsi11G011560 vs. NCBI nr
Match: XP_008448012.1 (PREDICTED: auxin-responsive protein SAUR21-like [Cucumis melo] >KAA0049686.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa] >TYK12186.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa]) HSP 1 Score: 172.6 bits (436), Expect = 1.5e-39 Identity = 80/84 (95.24%), Postives = 82/84 (97.62%), Query Frame = 0
BLAST of Lsi11G011560 vs. NCBI nr
Match: XP_038706687.1 (auxin-induced protein 15A-like [Tripterygium wilfordii]) HSP 1 Score: 127.1 bits (318), Expect = 7.2e-26 Identity = 62/91 (68.13%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of Lsi11G011560 vs. TAIR 10
Match: AT5G18030.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 120.2 bits (300), Expect = 8.1e-28 Identity = 53/72 (73.61%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Lsi11G011560 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.5 bits (293), Expect = 5.3e-27 Identity = 51/78 (65.38%), Postives = 62/78 (79.49%), Query Frame = 0
BLAST of Lsi11G011560 vs. TAIR 10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.1 bits (292), Expect = 6.9e-27 Identity = 51/77 (66.23%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of Lsi11G011560 vs. TAIR 10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.7 bits (291), Expect = 9.0e-27 Identity = 50/78 (64.10%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Lsi11G011560 vs. TAIR 10
Match: AT5G18060.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.9 bits (289), Expect = 1.5e-26 Identity = 51/78 (65.38%), Postives = 62/78 (79.49%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|