Lsi11G002310 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCCGCTGCTGTGATGGCTGAGACGACAAGAAACTTATCGGCGGCATATCAAATCGAATTTCTGTTTGATCTGGACATGGTTCTGTCCGGTGCCGACGACTTCGGTTGCTGCCAGATCAGCACTTCCGATTCCGTTGTGGCGGATTTGCCGACGGTGGTGGTCGATCTTTGTGCCGTTTGTTTGGAGGATTTCCGGCCAGATGAGGGCGGAAAACAAATCCCCTGCGGACACGTGTACCATGAGTCTTGTATTTCCTCTTGGCTTACCGTCGCCGACTGTTGCCCTCTCTGTCGGTGCCTCGTCGCCGGCCAACCGCCGGATTCTTCTTCTTCGACTTTGATCCGACGGTAG ATGGCTGCCGCTGCTGTGATGGCTGAGACGACAAGAAACTTATCGGCGGCATATCAAATCGAATTTCTGTTTGATCTGGACATGGTTCTGTCCGGTGCCGACGACTTCGGTTGCTGCCAGATCAGCACTTCCGATTCCGTTGTGGCGGATTTGCCGACGGTGGTGGTCGATCTTTGTGCCGTTTGTTTGGAGGATTTCCGGCCAGATGAGGGCGGAAAACAAATCCCCTGCGGACACGTGTACCATGAGTCTTGTATTTCCTCTTGGCTTACCGTCGCCGACTGTTGCCCTCTCTGTCGGTGCCTCGTCGCCGGCCAACCGCCGGATTCTTCTTCTTCGACTTTGATCCGACGGTAG ATGGCTGCCGCTGCTGTGATGGCTGAGACGACAAGAAACTTATCGGCGGCATATCAAATCGAATTTCTGTTTGATCTGGACATGGTTCTGTCCGGTGCCGACGACTTCGGTTGCTGCCAGATCAGCACTTCCGATTCCGTTGTGGCGGATTTGCCGACGGTGGTGGTCGATCTTTGTGCCGTTTGTTTGGAGGATTTCCGGCCAGATGAGGGCGGAAAACAAATCCCCTGCGGACACGTGTACCATGAGTCTTGTATTTCCTCTTGGCTTACCGTCGCCGACTGTTGCCCTCTCTGTCGGTGCCTCGTCGCCGGCCAACCGCCGGATTCTTCTTCTTCGACTTTGATCCGACGGTAG MAAAAVMAETTRNLSAAYQIEFLFDLDMVLSGADDFGCCQISTSDSVVADLPTVVVDLCAVCLEDFRPDEGGKQIPCGHVYHESCISSWLTVADCCPLCRCLVAGQPPDSSSSTLIRR Homology
BLAST of Lsi11G002310 vs. ExPASy Swiss-Prot
Match: Q9VHI7 (E3 ubiquitin-protein ligase Iruka OS=Drosophila melanogaster OX=7227 GN=Iru PE=1 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.0e-09 Identity = 22/52 (42.31%), Postives = 35/52 (67.31%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy Swiss-Prot
Match: Q9D0C1 (E3 ubiquitin-protein ligase RNF115 OS=Mus musculus OX=10090 GN=Rnf115 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 5.2e-09 Identity = 30/75 (40.00%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy Swiss-Prot
Match: Q9Y4L5 (E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens OX=9606 GN=RNF115 PE=1 SV=2) HSP 1 Score: 61.6 bits (148), Expect = 6.8e-09 Identity = 29/75 (38.67%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy Swiss-Prot
Match: Q8LPN7 (E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana OX=3702 GN=At3g19950 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 6.8e-09 Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy Swiss-Prot
Match: P0CH30 (E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum OX=3635 GN=RING1 PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-08 Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy TrEMBL
Match: A0A6J1G511 (E3 ubiquitin-protein ligase RING1-like OS=Cucurbita moschata OX=3662 GN=LOC111450796 PE=4 SV=1) HSP 1 Score: 221.5 bits (563), Expect = 1.9e-54 Identity = 103/118 (87.29%), Postives = 110/118 (93.22%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy TrEMBL
Match: A0A0A0LKR7 (RING-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G000930 PE=4 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 1.6e-48 Identity = 97/118 (82.20%), Postives = 101/118 (85.59%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy TrEMBL
Match: A0A5A7V2P4 (RING-H2 finger protein ATL5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold332G00540 PE=4 SV=1) HSP 1 Score: 194.1 bits (492), Expect = 3.2e-46 Identity = 96/119 (80.67%), Postives = 100/119 (84.03%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy TrEMBL
Match: A0A1S4DZX3 (RING-H2 finger protein ATL5-like OS=Cucumis melo OX=3656 GN=LOC107991276 PE=4 SV=1) HSP 1 Score: 194.1 bits (492), Expect = 3.2e-46 Identity = 96/119 (80.67%), Postives = 100/119 (84.03%), Query Frame = 0
BLAST of Lsi11G002310 vs. ExPASy TrEMBL
Match: A0A6J1DM93 (E3 ubiquitin-protein ligase RHA1B-like OS=Momordica charantia OX=3673 GN=LOC111021870 PE=4 SV=1) HSP 1 Score: 183.3 bits (464), Expect = 5.7e-43 Identity = 87/115 (75.65%), Postives = 96/115 (83.48%), Query Frame = 0
BLAST of Lsi11G002310 vs. NCBI nr
Match: XP_022946863.1 (E3 ubiquitin-protein ligase RING1-like [Cucurbita moschata]) HSP 1 Score: 221.5 bits (563), Expect = 3.9e-54 Identity = 103/118 (87.29%), Postives = 110/118 (93.22%), Query Frame = 0
BLAST of Lsi11G002310 vs. NCBI nr
Match: KAG7030453.1 (E3 ubiquitin-protein ligase RING1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 220.3 bits (560), Expect = 8.7e-54 Identity = 102/118 (86.44%), Postives = 110/118 (93.22%), Query Frame = 0
BLAST of Lsi11G002310 vs. NCBI nr
Match: KAG6599476.1 (E3 ubiquitin-protein ligase RING1-like protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 220.3 bits (560), Expect = 8.7e-54 Identity = 102/118 (86.44%), Postives = 110/118 (93.22%), Query Frame = 0
BLAST of Lsi11G002310 vs. NCBI nr
Match: XP_023545409.1 (E3 ubiquitin-protein ligase RING1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 219.9 bits (559), Expect = 1.1e-53 Identity = 102/118 (86.44%), Postives = 109/118 (92.37%), Query Frame = 0
BLAST of Lsi11G002310 vs. NCBI nr
Match: XP_038877422.1 (E3 ubiquitin-protein ligase RNF181-like [Benincasa hispida]) HSP 1 Score: 209.5 bits (532), Expect = 1.5e-50 Identity = 101/118 (85.59%), Postives = 104/118 (88.14%), Query Frame = 0
BLAST of Lsi11G002310 vs. TAIR 10
Match: AT1G68180.1 (RING/U-box superfamily protein ) HSP 1 Score: 63.9 bits (154), Expect = 9.7e-11 Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of Lsi11G002310 vs. TAIR 10
Match: AT3G19950.1 (RING/U-box superfamily protein ) HSP 1 Score: 61.6 bits (148), Expect = 4.8e-10 Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of Lsi11G002310 vs. TAIR 10
Match: AT3G60080.1 (RING/U-box superfamily protein ) HSP 1 Score: 61.6 bits (148), Expect = 4.8e-10 Identity = 23/43 (53.49%), Postives = 29/43 (67.44%), Query Frame = 0
BLAST of Lsi11G002310 vs. TAIR 10
Match: AT2G44330.1 (RING/U-box superfamily protein ) HSP 1 Score: 60.8 bits (146), Expect = 8.2e-10 Identity = 22/42 (52.38%), Postives = 28/42 (66.67%), Query Frame = 0
BLAST of Lsi11G002310 vs. TAIR 10
Match: AT3G58720.1 (RING/U-box superfamily protein ) HSP 1 Score: 59.3 bits (142), Expect = 2.4e-09 Identity = 24/54 (44.44%), Postives = 30/54 (55.56%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|