Lsi10G004510 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCAAAAGGCCATGTGGCAGTTTATGTAGGAGAAATCCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCGTCGTTTCAACAACTGCTCAGCCACGCAGAGGAAGAGTTTGGCTTCCATCATCCTAAAGGAGGCCTAACAATTCCTTGCAAAGAAGATGCCTTCATTGATCTCACTTCTAGATTGCAAGTAGCTTGA ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCAAAAGGCCATGTGGCAGTTTATGTAGGAGAAATCCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCGTCGTTTCAACAACTGCTCAGCCACGCAGAGGAAGAGTTTGGCTTCCATCATCCTAAAGGAGGCCTAACAATTCCTTGCAAAGAAGATGCCTTCATTGATCTCACTTCTAGATTGCAAGTAGCTTGA ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCAAAAGGCCATGTGGCAGTTTATGTAGGAGAAATCCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCGTCGTTTCAACAACTGCTCAGCCACGCAGAGGAAGAGTTTGGCTTCCATCATCCTAAAGGAGGCCTAACAATTCCTTGCAAAGAAGATGCCTTCATTGATCTCACTTCTAGATTGCAAGTAGCTTGA MGIRFLSLVPHAKQILKMQSGFTKNQLDVPKGHVAVYVGEIQMKRFVVPISYLNHPSFQQLLSHAEEEFGFHHPKGGLTIPCKEDAFIDLTSRLQVA Homology
BLAST of Lsi10G004510 vs. ExPASy Swiss-Prot
Match: Q9FK62 (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana OX=3702 GN=SAUR24 PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.4e-23 Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy Swiss-Prot
Match: Q9FJG0 (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana OX=3702 GN=SAUR20 PE=1 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 6.8e-23 Identity = 52/79 (65.82%), Postives = 59/79 (74.68%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy Swiss-Prot
Match: Q9FJF7 (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana OX=3702 GN=SAUR22 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 48/66 (72.73%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy Swiss-Prot
Match: P33083 (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.0e-22 Identity = 51/81 (62.96%), Postives = 63/81 (77.78%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy Swiss-Prot
Match: Q9FJF9 (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana OX=3702 GN=SAUR21 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.6e-22 Identity = 48/66 (72.73%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy TrEMBL
Match: A0A6J1JHE3 (auxin-responsive protein SAUR24-like OS=Cucurbita maxima OX=3661 GN=LOC111484398 PE=3 SV=1) HSP 1 Score: 196.1 bits (497), Expect = 7.0e-47 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy TrEMBL
Match: A0A6J1FVI4 (auxin-responsive protein SAUR24-like OS=Cucurbita moschata OX=3662 GN=LOC111448832 PE=3 SV=1) HSP 1 Score: 196.1 bits (497), Expect = 7.0e-47 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy TrEMBL
Match: A0A6J1FU83 (auxin-responsive protein SAUR24-like OS=Cucurbita moschata OX=3662 GN=LOC111448831 PE=3 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 1.6e-46 Identity = 92/97 (94.85%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy TrEMBL
Match: A0A6J1FU85 (auxin-responsive protein SAUR23-like OS=Cucurbita moschata OX=3662 GN=LOC111448836 PE=3 SV=1) HSP 1 Score: 192.2 bits (487), Expect = 1.0e-45 Identity = 91/97 (93.81%), Postives = 94/97 (96.91%), Query Frame = 0
BLAST of Lsi10G004510 vs. ExPASy TrEMBL
Match: A0A6J1G6T7 (auxin-responsive protein SAUR24-like OS=Cucurbita moschata OX=3662 GN=LOC111451395 PE=3 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 2.9e-45 Identity = 90/97 (92.78%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of Lsi10G004510 vs. NCBI nr
Match: XP_038901159.1 (auxin-responsive protein SAUR24-like [Benincasa hispida]) HSP 1 Score: 196.4 bits (498), Expect = 1.1e-46 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Lsi10G004510 vs. NCBI nr
Match: XP_022944365.1 (auxin-responsive protein SAUR24-like [Cucurbita moschata] >XP_022944367.1 auxin-responsive protein SAUR24-like [Cucurbita moschata] >XP_022986731.1 auxin-responsive protein SAUR24-like [Cucurbita maxima] >XP_022986733.1 auxin-responsive protein SAUR24-like [Cucurbita maxima] >XP_022986734.1 auxin-responsive protein SAUR24-like [Cucurbita maxima] >XP_022986735.1 auxin-responsive protein SAUR24-like [Cucurbita maxima] >KAG6571048.1 Auxin-responsive protein SAUR24, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 196.1 bits (497), Expect = 1.4e-46 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Lsi10G004510 vs. NCBI nr
Match: XP_022944366.1 (auxin-responsive protein SAUR24-like [Cucurbita moschata] >KAG6571052.1 Auxin-responsive protein SAUR24, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 194.9 bits (494), Expect = 3.2e-46 Identity = 92/97 (94.85%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Lsi10G004510 vs. NCBI nr
Match: XP_023512611.1 (auxin-responsive protein SAUR24-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 194.9 bits (494), Expect = 3.2e-46 Identity = 92/97 (94.85%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Lsi10G004510 vs. NCBI nr
Match: KAG6571056.1 (Auxin-responsive protein SAUR24, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 193.0 bits (489), Expect = 1.2e-45 Identity = 92/97 (94.85%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of Lsi10G004510 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-27 Identity = 59/97 (60.82%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of Lsi10G004510 vs. TAIR 10
Match: AT4G34810.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.1 bits (292), Expect = 8.0e-27 Identity = 61/105 (58.10%), Postives = 76/105 (72.38%), Query Frame = 0
BLAST of Lsi10G004510 vs. TAIR 10
Match: AT2G21210.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.3 bits (290), Expect = 1.4e-26 Identity = 57/98 (58.16%), Postives = 72/98 (73.47%), Query Frame = 0
BLAST of Lsi10G004510 vs. TAIR 10
Match: AT4G34790.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.2 bits (274), Expect = 9.7e-25 Identity = 57/102 (55.88%), Postives = 71/102 (69.61%), Query Frame = 0
BLAST of Lsi10G004510 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.2 bits (274), Expect = 9.7e-25 Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|