Lsi06G007440 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGTGTTGTAGGCATTCGAGGAAAGTGGTTGAAGAGGTTAAAAGAGAGAGAGGGCAGAGATTCTGATGGTCTATTGACGTGTTGTAGGTGCTGGAGGAATGGAGTTGACGGTGGCACTTTGTTGTATTCACCAATGGAGATTGTAGCACCAGGTGCATTGAGTATATTGATTAAATTGATTTTTGCTTCCATTTTTACGCAATAGAATGATTTTATTTAAATCGAAACTATTTTGAATTGGTAATGCTATTGTATTTATGGATGTTTGACTGCATTCATTGAGATTATAATCAATATGATTAGGAAATGAAGAGATGGTAATATTCTAATGTCGAATGAATTGTAAACGTACTTGGAAATGTGCATAGCTACCTCTGAATCTTGAAATTCGTATACCGACTTTGAAAATGAAGTTCATTGAGTTCATAAGATAGCAAACTTTGATTGAAATTATTGCAAACGTACTTAACTTCATATGATCTATTTTATGGGTTGATGTAGGTCATGTTTGTTGGAATAATTGGTATGTGACCATTCGTGTAGAGTTATATTGTCTTGTGAATGAACATGTTTTTTCATTCCAAATTGAAGAAAAGACATGATTATTCCAATGGTCACGAATTAGTCTATAAATATGTCTCTTCTTCTGAGTAGCTTTATCGAGATTAGGAGCGAATTGCACAAAGGCTTCTAATTTGGCAAATTGAGCCAATTCCAATTTTGATTTGTTGGCTACTTGTTTCATGGCTTTAATTTAAGCTGTAGATCCTACCCTGGAGATGGAAATACCCACATTAATAGCAGGTTTGATTCTAGAATTAAATAGATCGGCAAATAAGAAATGTGTCCATTGGTAATGGAAATTACATTAGTAGGAATATAAACTGAAACATATATTTTGATTCATTAGAAATTGGACAAGTAAGGAAATTTCTCGTTGAGTTACGTACTTACGTAAAAACGAATAAACCTCAGTTTCAAGAAATCATATCTTCCACGAAGACATTCACCAATGAAGCAGAAGCCCTTTTGAAAAAATCTATTCAGGAATAG ATGACGTGCTGGAGGAATGGAGTTGACGGTGGCACTTTGTTGTATTCACCAATGGAGATTGTAGCACCAGAAATTGGACAAGTAAGGAAATTTCTCGTTGAGTTACGTACTTACGTAAAAACGAATAAACCTCAGTTTCAAGAAATCATATCTTCCACGAAGACATTCACCAATGAAGCAGAAGCCCTTTTGAAAAAATCTATTCAGGAATAG ATGACGTGCTGGAGGAATGGAGTTGACGGTGGCACTTTGTTGTATTCACCAATGGAGATTGTAGCACCAGAAATTGGACAAGTAAGGAAATTTCTCGTTGAGTTACGTACTTACGTAAAAACGAATAAACCTCAGTTTCAAGAAATCATATCTTCCACGAAGACATTCACCAATGAAGCAGAAGCCCTTTTGAAAAAATCTATTCAGGAATAG MTCWRNGVDGGTLLYSPMEIVAPEIGQVRKFLVELRTYVKTNKPQFQEIISSTKTFTNEAEALLKKSIQE Homology
BLAST of Lsi06G007440 vs. ExPASy Swiss-Prot
Match: Q49L13 (ATP synthase subunit alpha, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=atpA PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.0e-16 Identity = 44/47 (93.62%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy Swiss-Prot
Match: Q09X32 (ATP synthase subunit alpha, chloroplastic OS=Morus indica OX=248361 GN=atpA PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 4.4e-16 Identity = 43/47 (91.49%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy Swiss-Prot
Match: Q8S8Y3 (ATP synthase subunit alpha, chloroplastic OS=Atropa belladonna OX=33113 GN=atpA PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 5.8e-16 Identity = 42/47 (89.36%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy Swiss-Prot
Match: Q3C1H4 (ATP synthase subunit alpha, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=atpA PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 5.8e-16 Identity = 42/47 (89.36%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy Swiss-Prot
Match: Q33C53 (ATP synthase subunit alpha, chloroplastic OS=Nicotiana tomentosiformis OX=4098 GN=atpA PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 5.8e-16 Identity = 42/47 (89.36%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy TrEMBL
Match: A0A1P8LFL2 (ATP synthase subunit alpha OS=Citrullus mucosospermus OX=519315 GN=atpA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.5e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy TrEMBL
Match: A0A2Z2CGF6 (ATP synthase subunit alpha, chloroplastic OS=Coccinia grandis OX=387127 GN=atpA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.5e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy TrEMBL
Match: X2F439 (ATP synthase subunit alpha, chloroplastic OS=Lagenaria siceraria OX=3668 GN=atpA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.5e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy TrEMBL
Match: A0A1P8LD69 (ATP synthase subunit alpha OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=atpA PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.5e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. ExPASy TrEMBL
Match: A0A7T3USX6 (ATP synthase CF1 alpha subunit OS=Benincasa hispida OX=102211 GN=atpA PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.5e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. NCBI nr
Match: YP_009456131.1 (ATP synthase CF1 alpha subunit [Lagenaria siceraria] >QNM38516.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria var. microcarpa] >AHM88686.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria] >AHM88918.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria] >AHM88976.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria] >AHM89035.1 ATP synthase CF1 alpha subunit [Lagenaria siceraria]) HSP 1 Score: 88.2 bits (217), Expect = 3.1e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. NCBI nr
Match: YP_009317371.1 (ATP synthase CF1 alpha subunit [Coccinia grandis] >AOX48726.1 ATP synthase CF1 alpha subunit [Coccinia grandis] >AOX48811.1 ATP synthase CF1 alpha subunit [Coccinia grandis]) HSP 1 Score: 88.2 bits (217), Expect = 3.1e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. NCBI nr
Match: AHM90571.1 (ATP synthase CF1 alpha subunit [Lagenaria siceraria]) HSP 1 Score: 88.2 bits (217), Expect = 3.1e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. NCBI nr
Match: YP_010131079.1 (ATP synthase CF1 alpha subunit [Benincasa hispida] >QPZ75726.1 ATP synthase CF1 alpha subunit [Benincasa hispida] >QSQ72295.1 CF1 subunit alpha [Benincasa hispida]) HSP 1 Score: 88.2 bits (217), Expect = 3.1e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. NCBI nr
Match: YP_009325974.1 (ATP synthase CF1 alpha subunit [Citrullus lanatus] >YP_009348016.1 ATP synthase CF1 alpha subunit [Citrullus mucosospermus] >YP_009431542.1 ATP synthase CF1 alpha subunit [Citrullus amarus] >APW82446.1 ATP synthase CF1 alpha subunit [Citrullus lanatus subsp. vulgaris] >APD52465.1 ATP synthase CF1 alpha subunit [Citrullus lanatus] >APW82531.1 ATP synthase CF1 alpha subunit [Citrullus lanatus subsp. vulgaris] >APW82616.1 ATP synthase CF1 alpha subunit [Citrullus lanatus subsp. vulgaris] >APW82701.1 ATP synthase CF1 alpha subunit [Citrullus mucosospermus]) HSP 1 Score: 88.2 bits (217), Expect = 3.1e-14 Identity = 45/47 (95.74%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Lsi06G007440 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 76.3 bits (186), Expect = 1.1e-14 Identity = 38/47 (80.85%), Postives = 43/47 (91.49%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|