
Lsi05G006450 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGCCTACACTTGTCCATCTGTGAGATGCCACCCCTTTGATCCAGCTTTTATCGCCCAATCGAATGGAGGTTATATTGCAATATTCTCTCTAAATCCACCTTTCAAGTTAGACAAATACAAGAGGTATGGAAGTCATGGAGTCTCGGGCTTTCCAATAAAATGTAACTTCAGCCTTGATGCCAAGCAGATCATCTCTGGTTCTTCAGATGGCTCTATATATTTTTATGATTATAAATCCTCCTTGCTTATGCATAAACTAAAAGCATTTGAACAGGCTTGCATAGACATTGCCATCCACCCGACCTTACCTAATGTAATTGCTTCGAGCAGTTGGAATGGGAAGATCGCAGTGTTCCAGTGA ATGGAAGCCTACACTTGTCCATCTGTGAGATGCCACCCCTTTGATCCAGCTTTTATCGCCCAATCGAATGGAGGTTATATTGCAATATTCTCTCTAAATCCACCTTTCAAGTTAGACAAATACAAGAGGTATGGAAGTCATGGAGTCTCGGGCTTTCCAATAAAATGTAACTTCAGCCTTGATGCCAAGCAGATCATCTCTGGTTCTTCAGATGGCTCTATATATTTTTATGATTATAAATCCTCCTTGCTTATGCATAAACTAAAAGCATTTGAACAGGCTTGCATAGACATTGCCATCCACCCGACCTTACCTAATGTAATTGCTTCGAGCAGTTGGAATGGGAAGATCGCAGTGTTCCAGTGA ATGGAAGCCTACACTTGTCCATCTGTGAGATGCCACCCCTTTGATCCAGCTTTTATCGCCCAATCGAATGGAGGTTATATTGCAATATTCTCTCTAAATCCACCTTTCAAGTTAGACAAATACAAGAGGTATGGAAGTCATGGAGTCTCGGGCTTTCCAATAAAATGTAACTTCAGCCTTGATGCCAAGCAGATCATCTCTGGTTCTTCAGATGGCTCTATATATTTTTATGATTATAAATCCTCCTTGCTTATGCATAAACTAAAAGCATTTGAACAGGCTTGCATAGACATTGCCATCCACCCGACCTTACCTAATGTAATTGCTTCGAGCAGTTGGAATGGGAAGATCGCAGTGTTCCAGTGA MEAYTCPSVRCHPFDPAFIAQSNGGYIAIFSLNPPFKLDKYKRYGSHGVSGFPIKCNFSLDAKQIISGSSDGSIYFYDYKSSLLMHKLKAFEQACIDIAIHPTLPNVIASSSWNGKIAVFQ Homology
BLAST of Lsi05G006450 vs. ExPASy Swiss-Prot
Match: Q64LD2 (WD repeat-containing protein 25 OS=Homo sapiens OX=9606 GN=WDR25 PE=1 SV=3) HSP 1 Score: 110.9 bits (276), Expect = 1.0e-23 Identity = 43/119 (36.13%), Postives = 74/119 (62.18%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy Swiss-Prot
Match: E9Q349 (WD repeat-containing protein 25 OS=Mus musculus OX=10090 GN=Wdr25 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.8e-23 Identity = 43/119 (36.13%), Postives = 73/119 (61.34%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy Swiss-Prot
Match: O60508 (Pre-mRNA-processing factor 17 OS=Homo sapiens OX=9606 GN=CDC40 PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.8e-12 Identity = 34/117 (29.06%), Postives = 60/117 (51.28%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy Swiss-Prot
Match: Q9DC48 (Pre-mRNA-processing factor 17 OS=Mus musculus OX=10090 GN=Cdc40 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.8e-12 Identity = 34/117 (29.06%), Postives = 60/117 (51.28%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy Swiss-Prot
Match: Q9CAA0 (Coatomer subunit beta'-1 OS=Arabidopsis thaliana OX=3702 GN=At1g79990 PE=2 SV=2) HSP 1 Score: 45.4 bits (106), Expect = 5.2e-04 Identity = 34/109 (31.19%), Postives = 55/109 (50.46%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy TrEMBL
Match: A0A1S4DZ03 (WD repeat-containing protein 25 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103493399 PE=4 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 1.3e-61 Identity = 115/121 (95.04%), Postives = 117/121 (96.69%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy TrEMBL
Match: A0A0A0L568 (WD_REPEATS_REGION domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G088960 PE=4 SV=1) HSP 1 Score: 245.0 bits (624), Expect = 1.6e-61 Identity = 115/121 (95.04%), Postives = 117/121 (96.69%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy TrEMBL
Match: A0A6J1FN47 (WD repeat-containing protein 25 OS=Cucurbita moschata OX=3662 GN=LOC111446958 PE=4 SV=1) HSP 1 Score: 235.7 bits (600), Expect = 1.0e-58 Identity = 109/121 (90.08%), Postives = 112/121 (92.56%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy TrEMBL
Match: A0A6J1JQD9 (WD repeat-containing protein 25 OS=Cucurbita maxima OX=3661 GN=LOC111488910 PE=4 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 4.9e-58 Identity = 108/121 (89.26%), Postives = 111/121 (91.74%), Query Frame = 0
BLAST of Lsi05G006450 vs. ExPASy TrEMBL
Match: A0A6J1CMQ5 (WD repeat-containing protein 25 OS=Momordica charantia OX=3673 GN=LOC111012887 PE=4 SV=1) HSP 1 Score: 231.9 bits (590), Expect = 1.4e-57 Identity = 106/121 (87.60%), Postives = 110/121 (90.91%), Query Frame = 0
BLAST of Lsi05G006450 vs. NCBI nr
Match: XP_038903500.1 (WD repeat-containing protein 25 [Benincasa hispida]) HSP 1 Score: 248.1 bits (632), Expect = 4.0e-62 Identity = 116/121 (95.87%), Postives = 118/121 (97.52%), Query Frame = 0
BLAST of Lsi05G006450 vs. NCBI nr
Match: XP_016901209.1 (PREDICTED: WD repeat-containing protein 25 isoform X1 [Cucumis melo]) HSP 1 Score: 245.4 bits (625), Expect = 2.6e-61 Identity = 115/121 (95.04%), Postives = 117/121 (96.69%), Query Frame = 0
BLAST of Lsi05G006450 vs. NCBI nr
Match: XP_031738523.1 (WD repeat-containing protein 25 isoform X2 [Cucumis sativus]) HSP 1 Score: 245.0 bits (624), Expect = 3.4e-61 Identity = 115/121 (95.04%), Postives = 117/121 (96.69%), Query Frame = 0
BLAST of Lsi05G006450 vs. NCBI nr
Match: XP_011650540.1 (WD repeat-containing protein 25 isoform X1 [Cucumis sativus] >KAE8650152.1 hypothetical protein Csa_009510 [Cucumis sativus]) HSP 1 Score: 245.0 bits (624), Expect = 3.4e-61 Identity = 115/121 (95.04%), Postives = 117/121 (96.69%), Query Frame = 0
BLAST of Lsi05G006450 vs. NCBI nr
Match: XP_011650541.1 (WD repeat-containing protein 25 isoform X3 [Cucumis sativus] >XP_031738524.1 WD repeat-containing protein 25 isoform X3 [Cucumis sativus]) HSP 1 Score: 245.0 bits (624), Expect = 3.4e-61 Identity = 115/121 (95.04%), Postives = 117/121 (96.69%), Query Frame = 0
BLAST of Lsi05G006450 vs. TAIR 10
Match: AT5G54520.1 (Transducin/WD40 repeat-like superfamily protein ) HSP 1 Score: 183.7 bits (465), Expect = 8.6e-47 Identity = 77/121 (63.64%), Postives = 100/121 (82.64%), Query Frame = 0
BLAST of Lsi05G006450 vs. TAIR 10
Match: AT1G10580.1 (Transducin/WD40 repeat-like superfamily protein ) HSP 1 Score: 82.8 bits (203), Expect = 2.1e-16 Identity = 39/114 (34.21%), Postives = 61/114 (53.51%), Query Frame = 0
BLAST of Lsi05G006450 vs. TAIR 10
Match: AT1G79990.3 (structural molecules ) HSP 1 Score: 45.4 bits (106), Expect = 3.7e-05 Identity = 34/109 (31.19%), Postives = 55/109 (50.46%), Query Frame = 0
BLAST of Lsi05G006450 vs. TAIR 10
Match: AT1G79990.1 (structural molecules ) HSP 1 Score: 45.4 bits (106), Expect = 3.7e-05 Identity = 34/109 (31.19%), Postives = 55/109 (50.46%), Query Frame = 0
BLAST of Lsi05G006450 vs. TAIR 10
Match: AT1G79990.5 (structural molecules ) HSP 1 Score: 45.4 bits (106), Expect = 3.7e-05 Identity = 34/109 (31.19%), Postives = 55/109 (50.46%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|