
Lsi03G009580 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAGTATTTCAATCTTTTTTTATTTCATGTATTTTTCTAATCTCATTATGCGCATCACATAAAGGGGGAGCCGTATGAGATGAAAATCTCACGTACGGTTCTAGAACGAAGATTCTTTGAATGGAATAACGAACGACCGTAACGGATGTTAGCGCAATCCGAAGGAAATTATGCATAAGCTCTACAGAATTATTATGAAGCTATACGACTAGAAATCGATCCCTATGATCGAAGTTATATACTCTATAACATAGGTCTTATCCACACAAGGAATGGAGAACATACAAAAGCTTTGGAATATTATTTTCGGGCACTAGAACGAAACCCGTTCTTACCACAAGCTTTTAATAATATGGCTGTGATCTGTCATTACGTGCGACTATCTCCACTATAG ATGAGAAATTATTATGAAGCTATACGACTAGAAATCGATCCCTATGATCGAAGTTATATACTCTATAACATAGGTCTTATCCACACAAGGAATGGAGAACATACAAAAGCTTTGGAATATTATTTTCGGGCACTAGAACGAAACCCGTTCTTACCACAAGCTTTTAATAATATGGCTGTGATCTGTCATTACGTGCGACTATCTCCACTATAG ATGAGAAATTATTATGAAGCTATACGACTAGAAATCGATCCCTATGATCGAAGTTATATACTCTATAACATAGGTCTTATCCACACAAGGAATGGAGAACATACAAAAGCTTTGGAATATTATTTTCGGGCACTAGAACGAAACCCGTTCTTACCACAAGCTTTTAATAATATGGCTGTGATCTGTCATTACGTGCGACTATCTCCACTATAG MRNYYEAIRLEIDPYDRSYILYNIGLIHTRNGEHTKALEYYFRALERNPFLPQAFNNMAVICHYVRLSPL Homology
BLAST of Lsi03G009580 vs. ExPASy Swiss-Prot
Match: Q4VZH4 (Photosystem I assembly protein Ycf3 OS=Cucumis sativus OX=3659 GN=ycf3 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 2.2e-31 Identity = 61/64 (95.31%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy Swiss-Prot
Match: Q09X16 (Photosystem I assembly protein Ycf3 OS=Morus indica OX=248361 GN=ycf3 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 2.2e-31 Identity = 61/64 (95.31%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy Swiss-Prot
Match: P61843 (Photosystem I assembly protein Ycf3 OS=Arabidopsis thaliana OX=3702 GN=ycf3 PE=1 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.1e-30 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy Swiss-Prot
Match: Q8S8X3 (Photosystem I assembly protein Ycf3 OS=Atropa belladonna OX=33113 GN=ycf3 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.1e-30 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy Swiss-Prot
Match: Q53CF3 (Photosystem I assembly protein Ycf3 OS=Brassica juncea OX=3707 GN=ycf3 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.1e-30 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy TrEMBL
Match: A0A7J6HSE8 (TPR_REGION domain-containing protein OS=Cannabis sativa OX=3483 GN=G4B88_027368 PE=4 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 3.5e-32 Identity = 67/70 (95.71%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy TrEMBL
Match: A0A1N7TDX0 (Photosystem I assembly protein Ycf3 OS=Castanopsis concinna OX=1754207 GN=ycf3 PE=3 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 3.5e-32 Identity = 67/70 (95.71%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy TrEMBL
Match: A0A7U0IVV2 (Hypothetical chloroplast RF34 OS=Castanopsis carlesii OX=167382 GN=ycf3 PE=4 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 3.5e-32 Identity = 67/70 (95.71%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy TrEMBL
Match: X2F3U2 (Hypothetical chloroplast RF34 OS=Lagenaria siceraria OX=3668 GN=ycf3 PE=4 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 4.6e-32 Identity = 67/70 (95.71%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi03G009580 vs. ExPASy TrEMBL
Match: A0A6H1YHQ0 (Photosystem I assembly protein Ycf3 OS=Quercus coccinea OX=354624 GN=ycf3 PE=3 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 1.0e-31 Identity = 66/69 (95.65%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. NCBI nr
Match: YP_010149075.1 (hypothetical chloroplast RF34 [Castanopsis carlesii] >QQV69991.1 hypothetical chloroplast RF34 [Castanopsis carlesii]) HSP 1 Score: 146.7 bits (369), Expect = 7.3e-32 Identity = 67/70 (95.71%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. NCBI nr
Match: YP_009341778.1 (hypothetical chloroplast RF34 [Castanopsis concinna] >ALN96498.1 hypothetical chloroplast RF34 [Castanopsis concinna]) HSP 1 Score: 146.7 bits (369), Expect = 7.3e-32 Identity = 67/70 (95.71%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. NCBI nr
Match: WP_202958889.1 (tetratricopeptide repeat protein [Solirubrobacter sp. CPCC 204708] >KAF4397628.1 hypothetical protein G4B88_027368 [Cannabis sativa]) HSP 1 Score: 146.7 bits (369), Expect = 7.3e-32 Identity = 67/70 (95.71%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. NCBI nr
Match: AHM88684.1 (hypothetical chloroplast RF34 [Lagenaria siceraria] >AHM88743.1 hypothetical chloroplast RF34 [Lagenaria siceraria] >AHM88801.1 hypothetical chloroplast RF34 [Lagenaria siceraria] >AHM88859.1 hypothetical chloroplast RF34 [Lagenaria siceraria] >AHM88916.1 hypothetical chloroplast RF34 [Lagenaria siceraria]) HSP 1 Score: 146.4 bits (368), Expect = 9.5e-32 Identity = 67/70 (95.71%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi03G009580 vs. NCBI nr
Match: YP_009777019.1 (hypothetical chloroplast RF34 [Quercus coccinea] >QJA27824.1 hypothetical chloroplast RF34 [Quercus coccinea]) HSP 1 Score: 145.2 bits (365), Expect = 2.1e-31 Identity = 66/69 (95.65%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of Lsi03G009580 vs. TAIR 10
Match: ATCG00360.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 133.3 bits (334), Expect = 7.7e-32 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|