
Lcy12g008650 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCGTTTGTAGAGGCTGCCCTGGGACAAAATGATGCCCTGTTCCAAGGCCCAAAAGATGCTCAACTTGGTCATTGGGAACCGATTGAGAATATCAAGGACCCATATGTTCAAGAGATGGGAAGGTTTGCAGTGATGGAGCACAACAAGCAAATAATGGAGAAAATGGGAGCAAATCTTGAGTTCATTTGTGTGGTAAATGGTGACAAACAAGTGGTGGCTGGAGTGAATTATCGCCTTATAATAGAAGCAAGGAATGAAATGAAAATGGTTTGGACTTATGAGGCGATTGTGAATGATAGGCCATGGGAGAAGAAGTGGACGCTGATAACTTTTGTACCTTTGCTCAGGAACTGA ATGAGTTCGTTTGTAGAGGCTGCCCTGGGACAAAATGATGCCCTGTTCCAAGGCCCAAAAGATGCTCAACTTGGTCATTGGGAACCGATTGAGAATATCAAGGACCCATATGTTCAAGAGATGGGAAGGTTTGCAGTGATGGAGCACAACAAGCAAATAATGGAGAAAATGGGAGCAAATCTTGAGTTCATTTGTGTGGTAAATGGTGACAAACAAGTGGTGGCTGGAGTGAATTATCGCCTTATAATAGAAGCAAGGAATGAAATGAAAATGGTTTGGACTTATGAGGCGATTGTGAATGATAGGCCATGGGAGAAGAAGTGGACGCTGATAACTTTTGTACCTTTGCTCAGGAACTGA ATGAGTTCGTTTGTAGAGGCTGCCCTGGGACAAAATGATGCCCTGTTCCAAGGCCCAAAAGATGCTCAACTTGGTCATTGGGAACCGATTGAGAATATCAAGGACCCATATGTTCAAGAGATGGGAAGGTTTGCAGTGATGGAGCACAACAAGCAAATAATGGAGAAAATGGGAGCAAATCTTGAGTTCATTTGTGTGGTAAATGGTGACAAACAAGTGGTGGCTGGAGTGAATTATCGCCTTATAATAGAAGCAAGGAATGAAATGAAAATGGTTTGGACTTATGAGGCGATTGTGAATGATAGGCCATGGGAGAAGAAGTGGACGCTGATAACTTTTGTACCTTTGCTCAGGAACTGA MSSFVEAALGQNDALFQGPKDAQLGHWEPIENIKDPYVQEMGRFAVMEHNKQIMEKMGANLEFICVVNGDKQVVAGVNYRLIIEARNEMKMVWTYEAIVNDRPWEKKWTLITFVPLLRN Homology
BLAST of Lcy12g008650 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 78.2 bits (191), Expect = 7.1e-14 Identity = 45/105 (42.86%), Postives = 62/105 (59.05%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 77.8 bits (190), Expect = 9.2e-14 Identity = 42/94 (44.68%), Postives = 58/94 (61.70%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.6e-13 Identity = 44/105 (41.90%), Postives = 62/105 (59.05%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy Swiss-Prot
Match: Q10Q47 (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 43/104 (41.35%), Postives = 63/104 (60.58%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.8e-10 Identity = 36/88 (40.91%), Postives = 55/88 (62.50%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy TrEMBL
Match: A0A6J1IHH5 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475753 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 2.2e-34 Identity = 75/119 (63.03%), Postives = 92/119 (77.31%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy TrEMBL
Match: A0A6J1FCN1 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442885 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 3.7e-34 Identity = 74/119 (62.18%), Postives = 92/119 (77.31%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy TrEMBL
Match: A0A6J1FCN5 (cysteine proteinase inhibitor 8-like OS=Cucurbita moschata OX=3662 GN=LOC111442890 PE=4 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 1.4e-33 Identity = 74/119 (62.18%), Postives = 92/119 (77.31%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy TrEMBL
Match: A0A6J1IDU0 (cysteine proteinase inhibitor 8-like OS=Cucurbita maxima OX=3661 GN=LOC111475783 PE=4 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 4.1e-33 Identity = 73/119 (61.34%), Postives = 91/119 (76.47%), Query Frame = 0
BLAST of Lcy12g008650 vs. ExPASy TrEMBL
Match: A0A6J1IK23 (cysteine proteinase inhibitor A-like OS=Cucurbita maxima OX=3661 GN=LOC111475738 PE=4 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 3.5e-32 Identity = 76/119 (63.87%), Postives = 87/119 (73.11%), Query Frame = 0
BLAST of Lcy12g008650 vs. NCBI nr
Match: XP_038897049.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 194.5 bits (493), Expect = 5.2e-46 Identity = 93/119 (78.15%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of Lcy12g008650 vs. NCBI nr
Match: XP_022975710.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 154.8 bits (390), Expect = 4.5e-34 Identity = 75/119 (63.03%), Postives = 92/119 (77.31%), Query Frame = 0
BLAST of Lcy12g008650 vs. NCBI nr
Match: XP_022936213.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 154.1 bits (388), Expect = 7.7e-34 Identity = 74/119 (62.18%), Postives = 92/119 (77.31%), Query Frame = 0
BLAST of Lcy12g008650 vs. NCBI nr
Match: XP_023536174.1 (cysteine proteinase inhibitor 8-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 153.7 bits (387), Expect = 1.0e-33 Identity = 75/119 (63.03%), Postives = 93/119 (78.15%), Query Frame = 0
BLAST of Lcy12g008650 vs. NCBI nr
Match: KAG6592144.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 152.5 bits (384), Expect = 2.3e-33 Identity = 73/119 (61.34%), Postives = 93/119 (78.15%), Query Frame = 0
BLAST of Lcy12g008650 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 77.8 bits (190), Expect = 6.6e-15 Identity = 42/94 (44.68%), Postives = 58/94 (61.70%), Query Frame = 0
BLAST of Lcy12g008650 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 62.4 bits (150), Expect = 2.9e-10 Identity = 36/93 (38.71%), Postives = 54/93 (58.06%), Query Frame = 0
BLAST of Lcy12g008650 vs. TAIR 10
Match: AT2G31980.1 (PHYTOCYSTATIN 2 ) HSP 1 Score: 46.6 bits (109), Expect = 1.6e-05 Identity = 32/112 (28.57%), Postives = 53/112 (47.32%), Query Frame = 0
BLAST of Lcy12g008650 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 45.1 bits (105), Expect = 4.7e-05 Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 0
BLAST of Lcy12g008650 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 42.7 bits (99), Expect = 2.3e-04 Identity = 33/78 (42.31%), Postives = 39/78 (50.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|