
Lcy11g011660 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCTGCTCTACTTCTCAACAATCTATTGGGGTATCTTCTCTTCTATTTCAAGCCATTAGCGCCCTCCCAAAAGAAAGAATGATGCTTGAAAAAGAAAGATCCTTAGGAATGTACAGGCTCTCATCGTACTTCATCTTAAGGTCCACAAGCAAGCCTCCCAGTGGAGCTCGGTCTTTCCACCATTTTCATCTTCATAATCTATTGGATGGCGAGCTTGAAACGCTTCACCACAAGCTTCTTTGCCACTCTATTCTCTCAACTCCTCAGCGTTTTAGTGTCCCAAAGGCTCTAGCTTGGCCGTTGGCAGCCTTGTTTTGGACCAAAGTTCAGCCACCATACTTGGTTCAGTCATCATGCTTTATTTCCTTGTAA ATGGGCTGCTCTACTTCTCAACAATCTATTGGGGTATCTTCTCTTCTATTTCAAGCCATTAGCGCCCTCCCAAAAGAAAGAATGATGCTTGAAAAAGAAAGATCCTTAGGAATGTACAGGCTCTCATCGTACTTCATCTTAAGGTCCACAAGCAAGCCTCCCAGTGGAGCTCGGTCTTTCCACCATTTTCATCTTCATAATCTATTGGATGGCGAGCTTGAAACGCTTCACCACAAGCTTCTTTGCCACTCTATTCTCTCAACTCCTCAGCGTTTTAGTGTCCCAAAGGCTCTAGCTTGGCCGTTGGCAGCCTTGTTTTGGACCAAAGTTCAGCCACCATACTTGGTTCAGTCATCATGCTTTATTTCCTTGTAA ATGGGCTGCTCTACTTCTCAACAATCTATTGGGGTATCTTCTCTTCTATTTCAAGCCATTAGCGCCCTCCCAAAAGAAAGAATGATGCTTGAAAAAGAAAGATCCTTAGGAATGTACAGGCTCTCATCGTACTTCATCTTAAGGTCCACAAGCAAGCCTCCCAGTGGAGCTCGGTCTTTCCACCATTTTCATCTTCATAATCTATTGGATGGCGAGCTTGAAACGCTTCACCACAAGCTTCTTTGCCACTCTATTCTCTCAACTCCTCAGCGTTTTAGTGTCCCAAAGGCTCTAGCTTGGCCGTTGGCAGCCTTGTTTTGGACCAAAGTTCAGCCACCATACTTGGTTCAGTCATCATGCTTTATTTCCTTGTAA MGCSTSQQSIGVSSLLFQAISALPKERMMLEKERSLGMYRLSSYFILRSTSKPPSGARSFHHFHLHNLLDGELETLHHKLLCHSILSTPQRFSVPKALAWPLAALFWTKVQPPYLVQSSCFISL Homology
BLAST of Lcy11g011660 vs. ExPASy Swiss-Prot
Match: Q93YS4 (ABC transporter G family member 22 OS=Arabidopsis thaliana OX=3702 GN=ABCG22 PE=1 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 1.1e-04 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy Swiss-Prot
Match: Q9FT51 (ABC transporter G family member 27 OS=Arabidopsis thaliana OX=3702 GN=ABCG27 PE=2 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 3.1e-04 Identity = 22/39 (56.41%), Postives = 27/39 (69.23%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy Swiss-Prot
Match: Q9SZR9 (ABC transporter G family member 9 OS=Arabidopsis thaliana OX=3702 GN=ABCG9 PE=1 SV=2) HSP 1 Score: 46.2 bits (108), Expect = 3.1e-04 Identity = 23/39 (58.97%), Postives = 26/39 (66.67%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy Swiss-Prot
Match: Q7XA72 (ABC transporter G family member 21 OS=Arabidopsis thaliana OX=3702 GN=ABCG21 PE=2 SV=2) HSP 1 Score: 45.4 bits (106), Expect = 5.3e-04 Identity = 23/39 (58.97%), Postives = 27/39 (69.23%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy Swiss-Prot
Match: Q9C6W5 (ABC transporter G family member 14 OS=Arabidopsis thaliana OX=3702 GN=ABCG14 PE=1 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 9.0e-04 Identity = 21/39 (53.85%), Postives = 27/39 (69.23%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy TrEMBL
Match: A0A5A7V4M5 (ABC transporter G family member 9-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold22G005910 PE=4 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 8.5e-05 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy TrEMBL
Match: A0A5D3BVZ6 (ABC transporter G family member 9-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold298G001470 PE=4 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 8.5e-05 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy TrEMBL
Match: A0A1S3BUF9 (ABC transporter G family member 9-like OS=Cucumis melo OX=3656 GN=LOC103493419 PE=4 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 8.5e-05 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy TrEMBL
Match: A0A5C7GS18 (Alpha-galactosidase OS=Acer yangbiense OX=1000413 GN=EZV62_026634 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.1e-04 Identity = 27/39 (69.23%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Lcy11g011660 vs. ExPASy TrEMBL
Match: A0A0A0L374 (ABC transporter domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G101820 PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 1.4e-04 Identity = 27/39 (69.23%), Postives = 31/39 (79.49%), Query Frame = 0
BLAST of Lcy11g011660 vs. NCBI nr
Match: KAA0060689.1 (ABC transporter G family member 9-like [Cucumis melo var. makuwa]) HSP 1 Score: 56.6 bits (135), Expect = 1.8e-04 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Lcy11g011660 vs. NCBI nr
Match: TYK03304.1 (ABC transporter G family member 9-like [Cucumis melo var. makuwa]) HSP 1 Score: 56.6 bits (135), Expect = 1.8e-04 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Lcy11g011660 vs. NCBI nr
Match: XP_008452359.2 (PREDICTED: ABC transporter G family member 9-like [Cucumis melo]) HSP 1 Score: 56.6 bits (135), Expect = 1.8e-04 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Lcy11g011660 vs. NCBI nr
Match: XP_038906339.1 (ABC transporter G family member 9 [Benincasa hispida]) HSP 1 Score: 56.2 bits (134), Expect = 2.3e-04 Identity = 28/39 (71.79%), Postives = 31/39 (79.49%), Query Frame = 0
BLAST of Lcy11g011660 vs. NCBI nr
Match: TXG47340.1 (hypothetical protein EZV62_026634 [Acer yangbiense]) HSP 1 Score: 56.2 bits (134), Expect = 2.3e-04 Identity = 27/39 (69.23%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Lcy11g011660 vs. TAIR 10
Match: AT5G06530.2 (ABC-2 type transporter family protein ) HSP 1 Score: 47.8 bits (112), Expect = 7.6e-06 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 0
BLAST of Lcy11g011660 vs. TAIR 10
Match: AT5G06530.1 (ABC-2 type transporter family protein ) HSP 1 Score: 47.8 bits (112), Expect = 7.6e-06 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 0
BLAST of Lcy11g011660 vs. TAIR 10
Match: AT5G06530.3 (ABC-2 type transporter family protein ) HSP 1 Score: 47.8 bits (112), Expect = 7.6e-06 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 0
BLAST of Lcy11g011660 vs. TAIR 10
Match: AT3G52310.1 (ABC-2 type transporter family protein ) HSP 1 Score: 46.2 bits (108), Expect = 2.2e-05 Identity = 22/39 (56.41%), Postives = 27/39 (69.23%), Query Frame = 0
BLAST of Lcy11g011660 vs. TAIR 10
Match: AT4G27420.1 (ABC-2 type transporter family protein ) HSP 1 Score: 46.2 bits (108), Expect = 2.2e-05 Identity = 23/39 (58.97%), Postives = 26/39 (66.67%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|