
Lcy04g020560 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CAGGAAGATGATAAGCTCTTTCGGAGTAAATGGTAGGGGTCATGCTGAACTCACGAATTACGTATCGATCTTTCCTCCCACTTCTACTAAGCGTTCTAGTTGAAGATGAAGAAGCCATTATGTTTTGGAGTCGATCTCTGAACTTACCCAGAAGGCAGAAACGAAACGAGACCATGATTCAATTCCTCCCTCAAGCAGCTTTTTCTTTGCCTTTATCTTTACTAGTGCTGATTTCATTGTTTGGATTCATGATCCCTTCTCGTTGCCAAGAAGTTCGCCTCTGCCCAGAATCCAATAATAACCACACGACCAACTCCTCCCATCTAGATTCTGACCTCAATTTCCTATTAGGTTCCTTGTCCGCCCAAGCTTCCTCCCACACTTTCTACAACGAGAGCTCTAATGGAATCTATGGCCTCTTCCTCTGCCGAGTGGATATTTCTAGCGAAGACTGTCATAGCTGTGTCGGAGATGCAGGTAAAAGAATCAAA CAGGAAGATGATAAGCTCTTTCGGAGTAAATGGTAGGGGTCATGCTGAACTCACGAATTACGTATCGATCTTTCCTCCCACTTCTACTAAGCGTTCTAGTTGAAGATGAAGAAGCCATTATGTTTTGGAGTCGATCTCTGAACTTACCCAGAAGGCAGAAACGAAACGAGACCATGATTCAATTCCTCCCTCAAGCAGCTTTTTCTTTGCCTTTATCTTTACTAGTGCTGATTTCATTGTTTGGATTCATGATCCCTTCTCGTTGCCAAGAAGTTCGCCTCTGCCCAGAATCCAATAATAACCACACGACCAACTCCTCCCATCTAGATTCTGACCTCAATTTCCTATTAGGTTCCTTGTCCGCCCAAGCTTCCTCCCACACTTTCTACAACGAGAGCTCTAATGGAATCTATGGCCTCTTCCTCTGCCGAGTGGATATTTCTAGCGAAGACTGTCATAGCTGTGTCGGAGATGCAGGTAAAAGAATCAAA ATGGTAGGGGTCATGCTGAACTCACGAATTACGTATCGATCTTTCCTCCCACTTCTACTAAGCGTTCTAGTTGAAGATGAAGAAGCCATTATGTTTTGGAGTCGATCTCTGAACTTACCCAGAAGGCAGAAACGAAACGAGACCATGATTCAATTCCTCCCTCAAGCAGCTTTTTCTTTGCCTTTATCTTTACTAGTGCTGATTTCATTGTTTGGATTCATGATCCCTTCTCGTTGCCAAGAAGTTCGCCTCTGCCCAGAATCCAATAATAACCACACGACCAACTCCTCCCATCTAGATTCTGACCTCAATTTCCTATTAGGTTCCTTGTCCGCCCAAGCTTCCTCCCACACTTTCTACAACGAGAGCTCTAATGGAATCTATGGCCTCTTCCTCTGCCGAGTGGATATTTCTAGCGAAGACTGTCATAGCTGTGTCGGAGATGCAGGTAAAAGAATCAAA MVGVMLNSRITYRSFLPLLLSVLVEDEEAIMFWSRSLNLPRRQKRNETMIQFLPQAAFSLPLSLLVLISLFGFMIPSRCQEVRLCPESNNNHTTNSSHLDSDLNFLLGSLSAQASSHTFYNESSNGIYGLFLCRVDISSEDCHSCVGDAGKRIK Homology
BLAST of Lcy04g020560 vs. ExPASy Swiss-Prot
Match: Q9SYB1 (Cysteine-rich repeat secretory protein 1 OS=Arabidopsis thaliana OX=3702 GN=CRRSP1 PE=3 SV=3) HSP 1 Score: 54.3 bits (129), Expect = 1.4e-06 Identity = 38/105 (36.19%), Postives = 57/105 (54.29%), Query Frame = 0
BLAST of Lcy04g020560 vs. ExPASy Swiss-Prot
Match: Q9FHD5 (Cysteine-rich repeat secretory protein 57 OS=Arabidopsis thaliana OX=3702 GN=CRRSP57 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.7e-04 Identity = 25/69 (36.23%), Postives = 46/69 (66.67%), Query Frame = 0
BLAST of Lcy04g020560 vs. ExPASy Swiss-Prot
Match: Q9LV60 (Cysteine-rich repeat secretory protein 55 OS=Arabidopsis thaliana OX=3702 GN=CRRSP55 PE=2 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 2.3e-04 Identity = 26/78 (33.33%), Postives = 46/78 (58.97%), Query Frame = 0
BLAST of Lcy04g020560 vs. ExPASy TrEMBL
Match: A0A0A0KLA4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G516600 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.4e-17 Identity = 52/106 (49.06%), Postives = 71/106 (66.98%), Query Frame = 0
BLAST of Lcy04g020560 vs. ExPASy TrEMBL
Match: A0A6J1GFK8 (cysteine-rich repeat secretory protein 38-like OS=Cucurbita moschata OX=3662 GN=LOC111453478 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 4.1e-17 Identity = 54/106 (50.94%), Postives = 74/106 (69.81%), Query Frame = 0
BLAST of Lcy04g020560 vs. ExPASy TrEMBL
Match: A0A5D3CPW4 (Putative cysteine-rich receptor-like protein kinase 23 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G006800 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.2e-16 Identity = 53/106 (50.00%), Postives = 70/106 (66.04%), Query Frame = 0
BLAST of Lcy04g020560 vs. ExPASy TrEMBL
Match: A0A6J1IPP5 (cysteine-rich repeat secretory protein 38 OS=Cucurbita maxima OX=3661 GN=LOC111477688 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-16 Identity = 53/106 (50.00%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of Lcy04g020560 vs. ExPASy TrEMBL
Match: A0A1S3AZY9 (LOW QUALITY PROTEIN: uncharacterized protein LOC103484582 OS=Cucumis melo OX=3656 GN=LOC103484582 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 8.1e-13 Identity = 57/141 (40.43%), Postives = 86/141 (60.99%), Query Frame = 0
BLAST of Lcy04g020560 vs. NCBI nr
Match: KAG7033926.1 (Cysteine-rich repeat secretory protein 38, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 99.8 bits (247), Expect = 2.2e-17 Identity = 54/106 (50.94%), Postives = 75/106 (70.75%), Query Frame = 0
BLAST of Lcy04g020560 vs. NCBI nr
Match: KAG6603755.1 (Cysteine-rich repeat secretory protein 38, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 99.8 bits (247), Expect = 2.2e-17 Identity = 54/106 (50.94%), Postives = 75/106 (70.75%), Query Frame = 0
BLAST of Lcy04g020560 vs. NCBI nr
Match: KGN49521.2 (hypothetical protein Csa_003698 [Cucumis sativus]) HSP 1 Score: 98.6 bits (244), Expect = 5.0e-17 Identity = 52/106 (49.06%), Postives = 71/106 (66.98%), Query Frame = 0
BLAST of Lcy04g020560 vs. NCBI nr
Match: XP_023544492.1 (cysteine-rich repeat secretory protein 38 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 97.8 bits (242), Expect = 8.5e-17 Identity = 54/106 (50.94%), Postives = 74/106 (69.81%), Query Frame = 0
BLAST of Lcy04g020560 vs. NCBI nr
Match: XP_022950364.1 (cysteine-rich repeat secretory protein 38-like [Cucurbita moschata]) HSP 1 Score: 97.8 bits (242), Expect = 8.5e-17 Identity = 54/106 (50.94%), Postives = 74/106 (69.81%), Query Frame = 0
BLAST of Lcy04g020560 vs. TAIR 10
Match: AT1G61750.1 (Receptor-like protein kinase-related family protein ) HSP 1 Score: 54.3 bits (129), Expect = 1.0e-07 Identity = 38/105 (36.19%), Postives = 57/105 (54.29%), Query Frame = 0
BLAST of Lcy04g020560 vs. TAIR 10
Match: AT5G41280.1 (Receptor-like protein kinase-related family protein ) HSP 1 Score: 47.4 bits (111), Expect = 1.2e-05 Identity = 25/69 (36.23%), Postives = 46/69 (66.67%), Query Frame = 0
BLAST of Lcy04g020560 vs. TAIR 10
Match: AT5G48540.1 (receptor-like protein kinase-related family protein ) HSP 1 Score: 47.0 bits (110), Expect = 1.6e-05 Identity = 26/78 (33.33%), Postives = 46/78 (58.97%), Query Frame = 0
BLAST of Lcy04g020560 vs. TAIR 10
Match: AT4G23270.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 19 ) HSP 1 Score: 43.5 bits (101), Expect = 1.8e-04 Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 0
BLAST of Lcy04g020560 vs. TAIR 10
Match: AT4G05200.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 25 ) HSP 1 Score: 43.5 bits (101), Expect = 1.8e-04 Identity = 35/100 (35.00%), Postives = 53/100 (53.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|