IVF0025681 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAAATAAATGTTCTTCACACTAACCATGTCTTTTATTTATGTAAATTATATATATAATAATTATTCGTTAATTTGTTTTAATTTTAACTTCTTGTTGTGATGAAAATCACAAGGTAAAACATCGTGGCCGGAACTGATCGGAAAACATGGAAAGGTGGCGGAGGAGATGATAGAGAGAGAGGTTCCATGGGTAAATGCTAAGGTTGTACAAGAAGGAACCACTTTTGTTACTGCTGATTATAATTGTAATAGGGTTTGGGTTTGGGTTAATAAACATGGCTTTGTTACTAGAATTCCCATTATTGGTTAA ATGGTAAATAAATGTAAAACATCGTGGCCGGAACTGATCGGAAAACATGGAAAGGTGGCGGAGGAGATGATAGAGAGAGAGGTTCCATGGGTAAATGCTAAGGTTGTACAAGAAGGAACCACTTTTGTTACTGCTGATTATAATTGTAATAGGGTTTGGGTTTGGGTTAATAAACATGGCTTTGTTACTAGAATTCCCATTATTGGTTAA ATGGTAAATAAATGTAAAACATCGTGGCCGGAACTGATCGGAAAACATGGAAAGGTGGCGGAGGAGATGATAGAGAGAGAGGTTCCATGGGTAAATGCTAAGGTTGTACAAGAAGGAACCACTTTTGTTACTGCTGATTATAATTGTAATAGGGTTTGGGTTTGGGTTAATAAACATGGCTTTGTTACTAGAATTCCCATTATTGGTTAA MVNKCKTSWPELIGKHGKVAEEMIEREVPWVNAKVVQEGTTFVTADYNCNRVWVWVNKHGFVTRIPIIG Homology
BLAST of IVF0025681 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.9e-12 Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy Swiss-Prot
Match: P24076 (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.3e-11 Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.3e-11 Identity = 32/63 (50.79%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy Swiss-Prot
Match: P80211 (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.4e-08 Identity = 29/61 (47.54%), Postives = 38/61 (62.30%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy Swiss-Prot
Match: P05118 (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 GN=PIIF PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.1e-06 Identity = 27/64 (42.19%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy TrEMBL
Match: A0A444XQ64 (Glu S.griseus protease inhibitor OS=Arachis hypogaea OX=3818 GN=Ahy_B09g097926 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 6.6e-15 Identity = 41/64 (64.06%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy TrEMBL
Match: A0A445BI04 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A09g043293 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 8.6e-15 Identity = 41/64 (64.06%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy TrEMBL
Match: A0A6P5MSW9 (glu S.griseus protease inhibitor-like OS=Arachis duranensis OX=130453 GN=LOC110275866 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 8.6e-15 Identity = 41/64 (64.06%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy TrEMBL
Match: A0A4D6N565 (Proteinase inhibitor I13 OS=Vigna unguiculata OX=3917 GN=DEO72_LG9g2649 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.5e-14 Identity = 40/66 (60.61%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of IVF0025681 vs. ExPASy TrEMBL
Match: A0A540KWC4 (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_035894 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 1.9e-14 Identity = 42/71 (59.15%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of IVF0025681 vs. NCBI nr
Match: KAG7018770.1 (hypothetical protein SDJN02_20643, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 127 bits (320), Expect = 7.87e-37 Identity = 56/64 (87.50%), Postives = 59/64 (92.19%), Query Frame = 0
BLAST of IVF0025681 vs. NCBI nr
Match: XP_020966911.1 (glu S.griseus protease inhibitor-like [Arachis ipaensis] >XP_025677502.1 glu S.griseus protease inhibitor-like [Arachis hypogaea] >QHN78257.1 Glu S.griseus protease inhibitor [Arachis hypogaea] >RYQ91879.1 hypothetical protein Ahy_B09g097926 [Arachis hypogaea]) HSP 1 Score: 90.1 bits (222), Expect = 7.06e-22 Identity = 41/64 (64.06%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of IVF0025681 vs. NCBI nr
Match: XP_020987874.1 (glu S.griseus protease inhibitor-like [Arachis duranensis] >QHO35154.1 Glu S.griseus protease inhibitor [Arachis hypogaea] >RYR38297.1 hypothetical protein Ahy_A09g043293 [Arachis hypogaea]) HSP 1 Score: 89.7 bits (221), Expect = 1.00e-21 Identity = 41/64 (64.06%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of IVF0025681 vs. NCBI nr
Match: QCE07629.1 (Proteinase inhibitor I13 [Vigna unguiculata]) HSP 1 Score: 89.0 bits (219), Expect = 2.02e-21 Identity = 40/66 (60.61%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of IVF0025681 vs. NCBI nr
Match: KAF3440613.1 (hypothetical protein FNV43_RR18897 [Rhamnella rubrinervis]) HSP 1 Score: 90.1 bits (222), Expect = 3.93e-21 Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 0
BLAST of IVF0025681 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 69.3 bits (168), Expect = 1.4e-12 Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of IVF0025681 vs. TAIR 10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 61.2 bits (147), Expect = 3.7e-10 Identity = 30/62 (48.39%), Postives = 41/62 (66.13%), Query Frame = 0
BLAST of IVF0025681 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 60.5 bits (145), Expect = 6.3e-10 Identity = 31/64 (48.44%), Postives = 42/64 (65.62%), Query Frame = 0
BLAST of IVF0025681 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 55.1 bits (131), Expect = 2.6e-08 Identity = 28/64 (43.75%), Postives = 43/64 (67.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|