IVF0018674 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCAAGGTTGTGGGCAACTCTGCCAAGATGATTGTTGCTTTCCTTTTCCTTTTGGCCCTCACGCTTTCCATGAATGGTAATTAACGAAGCACATAAGAAATTGTATAGAAAGAAATTATTTTATGAAAACCAGTTGTTACATGAGTTTTGTTTTTGTTGTTTTTTTTCTTTTTTCACTTCAGAAAAGCAAGGGGTGGTGGAGGCAAAGGTGTGCGAGAGGCGAAGCAAGACGTGGTCGGGATGGTGCGGGGACACGAAGCATTGCGATCGGCAATGCAAGAATTGGGAAGGTGCGAAACATGGAGCTTGCCATGCTCAATTTCCTGGAAGAGCTTGCTTTTGCTACTTCAACTGTTGA ATGGCCAAGGTTGTGGGCAACTCTGCCAAGATGATTGTTGCTTTCCTTTTCCTTTTGGCCCTCACGCTTTCCATGAATGAAAAGCAAGGGGTGGTGGAGGCAAAGGTGTGCGAGAGGCGAAGCAAGACGTGGTCGGGATGGTGCGGGGACACGAAGCATTGCGATCGGCAATGCAAGAATTGGGAAGGTGCGAAACATGGAGCTTGCCATGCTCAATTTCCTGGAAGAGCTTGCTTTTGCTACTTCAACTGTTGA ATGGCCAAGGTTGTGGGCAACTCTGCCAAGATGATTGTTGCTTTCCTTTTCCTTTTGGCCCTCACGCTTTCCATGAATGAAAAGCAAGGGGTGGTGGAGGCAAAGGTGTGCGAGAGGCGAAGCAAGACGTGGTCGGGATGGTGCGGGGACACGAAGCATTGCGATCGGCAATGCAAGAATTGGGAAGGTGCGAAACATGGAGCTTGCCATGCTCAATTTCCTGGAAGAGCTTGCTTTTGCTACTTCAACTGTTGA MAKVVGNSAKMIVAFLFLLALTLSMNEKQGVVEAKVCERRSKTWSGWCGDTKHCDRQCKNWEGAKHGACHAQFPGRACFCYFNC Homology
BLAST of IVF0018674 vs. ExPASy Swiss-Prot
Match: P82787 (Defensin-like protein 19 OS=Arabidopsis thaliana OX=3702 GN=PDF1.4 PE=3 SV=2) HSP 1 Score: 102.4 bits (254), Expect = 2.5e-21 Identity = 46/77 (59.74%), Postives = 56/77 (72.73%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy Swiss-Prot
Match: P0C8Y4 (Defensin-like protein 1 OS=Dahlia merckii OX=43367 PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.3e-16 Identity = 33/50 (66.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy Swiss-Prot
Match: P22357 (Anther-specific protein SF18 (Fragment) OS=Helianthus annuus OX=4232 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 3.8e-14 Identity = 31/53 (58.49%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy Swiss-Prot
Match: Q7M1F2 (Defensin-like protein 1 OS=Clitoria ternatea OX=43366 PE=1 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.0e-14 Identity = 32/49 (65.31%), Postives = 38/49 (77.55%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy Swiss-Prot
Match: O24332 (Defensin-like protein 3 OS=Raphanus sativus OX=3726 GN=AFP3 PE=3 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.0e-14 Identity = 37/73 (50.68%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy TrEMBL
Match: A0A5A7T656 (Defensin-like protein 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold110G002350 PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 5.3e-43 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy TrEMBL
Match: A0A1S3BZX7 (defensin-like protein 1 OS=Cucumis melo OX=3656 GN=LOC103495015 PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 5.3e-43 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy TrEMBL
Match: A0A0A0LFX9 (Knot1 domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G851940 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 2.5e-40 Identity = 80/84 (95.24%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy TrEMBL
Match: A0A6J1IJY9 (defensin-like protein 1 OS=Cucurbita maxima OX=3661 GN=LOC111476957 PE=4 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 8.8e-38 Identity = 75/84 (89.29%), Postives = 77/84 (91.67%), Query Frame = 0
BLAST of IVF0018674 vs. ExPASy TrEMBL
Match: A0A6J1FBE9 (defensin-like protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111442585 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 4.8e-36 Identity = 72/84 (85.71%), Postives = 76/84 (90.48%), Query Frame = 0
BLAST of IVF0018674 vs. NCBI nr
Match: XP_008454663.1 (PREDICTED: defensin-like protein 1 [Cucumis melo] >KAA0036859.1 defensin-like protein 1 [Cucumis melo var. makuwa] >TYJ95923.1 defensin-like protein 1 [Cucumis melo var. makuwa]) HSP 1 Score: 183 bits (465), Expect = 1.64e-58 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of IVF0018674 vs. NCBI nr
Match: XP_004150110.1 (defensin-like protein 1 [Cucumis sativus] >KGN59894.1 hypothetical protein Csa_001866 [Cucumis sativus]) HSP 1 Score: 174 bits (442), Expect = 5.31e-55 Identity = 80/84 (95.24%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of IVF0018674 vs. NCBI nr
Match: XP_038900009.1 (defensin-like protein 1 [Benincasa hispida]) HSP 1 Score: 171 bits (432), Expect = 1.78e-53 Identity = 76/84 (90.48%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of IVF0018674 vs. NCBI nr
Match: XP_022976615.1 (defensin-like protein 1 [Cucurbita maxima]) HSP 1 Score: 166 bits (420), Expect = 1.21e-51 Identity = 75/84 (89.29%), Postives = 77/84 (91.67%), Query Frame = 0
BLAST of IVF0018674 vs. NCBI nr
Match: XP_023535147.1 (defensin-like protein 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 162 bits (411), Expect = 2.86e-50 Identity = 73/84 (86.90%), Postives = 76/84 (90.48%), Query Frame = 0
BLAST of IVF0018674 vs. TAIR 10
Match: AT1G19610.1 (Arabidopsis defensin-like protein ) HSP 1 Score: 102.4 bits (254), Expect = 1.8e-22 Identity = 46/77 (59.74%), Postives = 56/77 (72.73%), Query Frame = 0
BLAST of IVF0018674 vs. TAIR 10
Match: AT2G26010.1 (plant defensin 1.3 ) HSP 1 Score: 74.3 bits (181), Expect = 5.1e-14 Identity = 36/74 (48.65%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of IVF0018674 vs. TAIR 10
Match: AT5G44430.1 (plant defensin 1.2C ) HSP 1 Score: 72.4 bits (176), Expect = 1.9e-13 Identity = 35/74 (47.30%), Postives = 45/74 (60.81%), Query Frame = 0
BLAST of IVF0018674 vs. TAIR 10
Match: AT2G26020.1 (plant defensin 1.2b ) HSP 1 Score: 70.1 bits (170), Expect = 9.7e-13 Identity = 33/74 (44.59%), Postives = 45/74 (60.81%), Query Frame = 0
BLAST of IVF0018674 vs. TAIR 10
Match: AT1G75830.1 (low-molecular-weight cysteine-rich 67 ) HSP 1 Score: 69.3 bits (168), Expect = 1.6e-12 Identity = 32/80 (40.00%), Postives = 43/80 (53.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|