IVF0016303 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTGGTGAGCCTGCATATCCATTTGCAACTCCTTTGGAAATATTGTTGAAATGGTATTTCTTTCCCGTATTTCAAATACTTCGTATAGTGCCAAAGAAGTTCTCGAGTGTTCTTTTAATGGTTTTTGTACCGGTGGGATTATTAACTGTATCATTTTTAAAGGATGTCAATAAATTCCAAAATCTATTTCGTCGTCTAATAGTGACAACCATCTTTTTGATTGGTATCGCAGTAACCCTTTGGTTTGGTATTGGAGCAACATTACCGATTGATAAATCCCTAACTTTAGATCTTTTTAAAATTGATTCAATTTTTAAATAA ATGATTGGTGAGCCTGCATATCCATTTGCAACTCCTTTGGAAATATTGTTGAAATGGTATTTCTTTCCCGTATTTCAAATACTTCGTATAGTGCCAAAGAAGTTCTCGAGTGTTCTTTTAATGGTTTTTGTACCGGTGGGATTATTAACTGTATCATTTTTAAAGGATGTCAATAAATTCCAAAATCTATTTCGTCGTCTAATAGTGACAACCATCTTTTTGATTGGTATCGCAGTAACCCTTTGGTTTGGTATTGGAGCAACATTACCGATTGATAAATCCCTAACTTTAGATCTTTTTAAAATTGATTCAATTTTTAAATAA ATGATTGGTGAGCCTGCATATCCATTTGCAACTCCTTTGGAAATATTGTTGAAATGGTATTTCTTTCCCGTATTTCAAATACTTCGTATAGTGCCAAAGAAGTTCTCGAGTGTTCTTTTAATGGTTTTTGTACCGGTGGGATTATTAACTGTATCATTTTTAAAGGATGTCAATAAATTCCAAAATCTATTTCGTCGTCTAATAGTGACAACCATCTTTTTGATTGGTATCGCAGTAACCCTTTGGTTTGGTATTGGAGCAACATTACCGATTGATAAATCCCTAACTTTAGATCTTTTTAAAATTGATTCAATTTTTAAATAA MIGEPAYPFATPLEILLKWYFFPVFQILRIVPKKFSSVLLMVFVPVGLLTVSFLKDVNKFQNLFRRLIVTTIFLIGIAVTLWFGIGATLPIDKSLTLDLFKIDSIFK Homology
BLAST of IVF0016303 vs. ExPASy Swiss-Prot
Match: Q14FC6 (Cytochrome b6-f complex subunit 4 OS=Populus alba OX=43335 GN=petD PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 5.4e-37 Identity = 81/105 (77.14%), Postives = 87/105 (82.86%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy Swiss-Prot
Match: Q7YJU7 (Cytochrome b6-f complex subunit 4 OS=Calycanthus floridus var. glaucus OX=212734 GN=petD PE=3 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 9.1e-37 Identity = 80/107 (74.77%), Postives = 87/107 (81.31%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy Swiss-Prot
Match: Q06GW6 (Cytochrome b6-f complex subunit 4 OS=Drimys granadensis OX=224735 GN=petD PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.6e-36 Identity = 80/103 (77.67%), Postives = 86/103 (83.50%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy Swiss-Prot
Match: Q3BAK6 (Cytochrome b6-f complex subunit 4 OS=Phalaenopsis aphrodite subsp. formosana OX=308872 GN=petD PE=3 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.5e-36 Identity = 79/103 (76.70%), Postives = 87/103 (84.47%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy Swiss-Prot
Match: Q6EW21 (Cytochrome b6-f complex subunit 4 OS=Nymphaea alba OX=34301 GN=petD PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 7.7e-36 Identity = 79/102 (77.45%), Postives = 85/102 (83.33%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy TrEMBL
Match: A0A0E3XDJ9 (Cytochrome b6-f complex subunit 4 OS=Quercus aquifolioides OX=1495044 GN=petD PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 8.0e-36 Identity = 83/107 (77.57%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy TrEMBL
Match: A0A650FD52 (Cytochrome b6-f complex subunit 4 OS=Casearia decandra OX=1186093 GN=petD PE=3 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 1.0e-35 Identity = 83/107 (77.57%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy TrEMBL
Match: A0A6H0ER51 (Cytochrome b6-f complex subunit 4 OS=Sechium edule OX=184140 GN=petD PE=3 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 1.0e-35 Identity = 84/107 (78.50%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy TrEMBL
Match: A0A6G9KX30 (Cytochrome b6-f complex subunit 4 OS=Garcinia gummi-gutta OX=1220707 GN=petD PE=3 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 1.4e-35 Identity = 83/107 (77.57%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. ExPASy TrEMBL
Match: A0A291B5P1 (Cytochrome b6-f complex subunit 4 OS=Bergenia scopulosa OX=1397840 GN=petD PE=3 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 1.8e-35 Identity = 84/107 (78.50%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. NCBI nr
Match: YP_009133083.1 (PetD [Quercus aquifolioides] >AKC05497.1 PetD [Quercus aquifolioides]) HSP 1 Score: 159 bits (401), Expect = 3.23e-47 Identity = 83/107 (77.57%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. NCBI nr
Match: QIT04164.1 (cytochrome b6/f subunit IV [Sechium edule]) HSP 1 Score: 158 bits (400), Expect = 4.58e-47 Identity = 84/107 (78.50%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. NCBI nr
Match: WP_206639772.1 (cytochrome b6-f complex subunit IV, partial [Vibrio vulnificus] >MBN8156776.1 cytochrome b6-f complex subunit IV [Vibrio vulnificus]) HSP 1 Score: 155 bits (393), Expect = 8.25e-47 Identity = 82/107 (76.64%), Postives = 88/107 (82.24%), Query Frame = 0
BLAST of IVF0016303 vs. NCBI nr
Match: QGU84438.1 (cytochrome b6/f complex subunit IV [Casearia decandra]) HSP 1 Score: 158 bits (400), Expect = 8.43e-47 Identity = 83/107 (77.57%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. NCBI nr
Match: YP_009760318.1 (cytochrome b6/f complex subunit IV [Garcinia gummi-gutta] >QIQ57121.1 cytochrome b6/f complex subunit IV [Garcinia gummi-gutta]) HSP 1 Score: 158 bits (399), Expect = 8.56e-47 Identity = 83/107 (77.57%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of IVF0016303 vs. TAIR 10
Match: ATCG00730.1 (photosynthetic electron transfer D ) HSP 1 Score: 147.1 bits (370), Expect = 7.9e-36 Identity = 77/100 (77.00%), Postives = 82/100 (82.00%), Query Frame = 0
BLAST of IVF0016303 vs. TAIR 10
Match: AT2G07727.1 (Di-haem cytochrome, transmembrane;Cytochrome b/b6, C-terminal ) HSP 1 Score: 41.2 bits (95), Expect = 6.1e-04 Identity = 23/61 (37.70%), Postives = 33/61 (54.10%), Query Frame = 0
BLAST of IVF0016303 vs. TAIR 10
Match: ATMG00220.1 (apocytochrome b ) HSP 1 Score: 41.2 bits (95), Expect = 6.1e-04 Identity = 23/61 (37.70%), Postives = 33/61 (54.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|