
IVF0015315 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTGTTGTAAACTACAAGGGTGAAGAGAAGCAGTTCTCTGCTGAAGAAATCTCTTCTATGGTGCTCATAAAGATGATTGCTGAGGCGTATCTCGGCACAACAGTGAAGAATGTTGTTGTCACTGTCTTGGCTTACTTCAACGATTCTCAGAGACAGGCCACCAAGGATGCTGGTGTCATTTTCGGCCTAAATGTGATGCGTATTATCAATGAACCAATAGCTGCCGCCATTGCTTATGGTCTTGACAAGAAGTTGAGCAGCTCTAACACAAATAATTGTTAA ATGATTGTTGTAAACTACAAGGGTGAAGAGAAGCAGTTCTCTGCTGAAGAAATCTCTTCTATGGTGCTCATAAAGATGATTGCTGAGGCGTATCTCGGCACAACAGTGAAGAATGTTGTTGTCACTGTCTTGGCTTACTTCAACGATTCTCAGAGACAGGCCACCAAGGATGCTGGTGTCATTTTCGGCCTAAATGTGATGCGTATTATCAATGAACCAATAGCTGCCGCCATTGCTTATGGTCTTGACAAGAAGTTGAGCAGCTCTAACACAAATAATTGTTAA ATGATTGTTGTAAACTACAAGGGTGAAGAGAAGCAGTTCTCTGCTGAAGAAATCTCTTCTATGGTGCTCATAAAGATGATTGCTGAGGCGTATCTCGGCACAACAGTGAAGAATGTTGTTGTCACTGTCTTGGCTTACTTCAACGATTCTCAGAGACAGGCCACCAAGGATGCTGGTGTCATTTTCGGCCTAAATGTGATGCGTATTATCAATGAACCAATAGCTGCCGCCATTGCTTATGGTCTTGACAAGAAGTTGAGCAGCTCTAACACAAATAATTGTTAA MIVVNYKGEEKQFSAEEISSMVLIKMIAEAYLGTTVKNVVVTVLAYFNDSQRQATKDAGVIFGLNVMRIINEPIAAAIAYGLDKKLSSSNTNNC Homology
BLAST of IVF0015315 vs. ExPASy Swiss-Prot
Match: P11143 (Heat shock 70 kDa protein OS=Zea mays OX=4577 GN=HSP70 PE=3 SV=2) HSP 1 Score: 146.7 bits (369), Expect = 1.3e-34 Identity = 80/95 (84.21%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy Swiss-Prot
Match: O65719 (Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana OX=3702 GN=HSP70-3 PE=1 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.7e-34 Identity = 79/95 (83.16%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy Swiss-Prot
Match: P09189 (Heat shock cognate 70 kDa protein OS=Petunia hybrida OX=4102 GN=HSP70 PE=2 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 2.2e-34 Identity = 80/95 (84.21%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy Swiss-Prot
Match: P27322 (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum OX=4081 GN=HSC-2 PE=2 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 4.9e-34 Identity = 81/95 (85.26%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy Swiss-Prot
Match: P22954 (Heat shock 70 kDa protein 2 OS=Arabidopsis thaliana OX=3702 GN=HSP70-2 PE=1 SV=2) HSP 1 Score: 143.3 bits (360), Expect = 1.4e-33 Identity = 79/95 (83.16%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy TrEMBL
Match: A0A5D3CR60 (Heat shock cognate 70 kDa protein-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold363G00430 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.6e-42 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy TrEMBL
Match: A0A5A7TWV4 (Heat shock cognate 70 kDa protein-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold754G00440 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.6e-42 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy TrEMBL
Match: A0A1S4E1V9 (heat shock cognate 70 kDa protein-like OS=Cucumis melo OX=3656 GN=LOC103497606 PE=4 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 7.0e-36 Identity = 86/96 (89.58%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy TrEMBL
Match: A0A5D3CI33 (Heat shock cognate 70 kDa protein-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold263G00050 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 3.5e-35 Identity = 86/96 (89.58%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of IVF0015315 vs. ExPASy TrEMBL
Match: A0A5A7SN84 (Heat shock cognate 70 kDa protein-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold19G00540 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 3.5e-35 Identity = 86/96 (89.58%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of IVF0015315 vs. NCBI nr
Match: TYK14065.1 (heat shock cognate 70 kDa protein-like [Cucumis melo var. makuwa]) HSP 1 Score: 179 bits (453), Expect = 2.90e-55 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of IVF0015315 vs. NCBI nr
Match: KAA0047388.1 (heat shock cognate 70 kDa protein-like [Cucumis melo var. makuwa]) HSP 1 Score: 179 bits (453), Expect = 4.37e-55 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of IVF0015315 vs. NCBI nr
Match: XP_016902212.1 (PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis melo] >XP_016902213.1 PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis melo] >XP_016902214.1 PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis melo]) HSP 1 Score: 159 bits (401), Expect = 5.33e-47 Identity = 86/96 (89.58%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of IVF0015315 vs. NCBI nr
Match: KAA0026113.1 (heat shock cognate 70 kDa protein-like [Cucumis melo var. makuwa]) HSP 1 Score: 156 bits (395), Expect = 4.34e-46 Identity = 86/96 (89.58%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of IVF0015315 vs. NCBI nr
Match: TYK11573.1 (heat shock cognate 70 kDa protein-like [Cucumis melo var. makuwa]) HSP 1 Score: 156 bits (395), Expect = 5.03e-46 Identity = 86/96 (89.58%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of IVF0015315 vs. TAIR 10
Match: AT3G09440.1 (Heat shock protein 70 (Hsp 70) family protein ) HSP 1 Score: 146.4 bits (368), Expect = 1.2e-35 Identity = 79/95 (83.16%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of IVF0015315 vs. TAIR 10
Match: AT3G09440.2 (Heat shock protein 70 (Hsp 70) family protein ) HSP 1 Score: 146.4 bits (368), Expect = 1.2e-35 Identity = 79/95 (83.16%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of IVF0015315 vs. TAIR 10
Match: AT3G12580.1 (heat shock protein 70 ) HSP 1 Score: 143.3 bits (360), Expect = 1.0e-34 Identity = 80/95 (84.21%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of IVF0015315 vs. TAIR 10
Match: AT5G02490.1 (Heat shock protein 70 (Hsp 70) family protein ) HSP 1 Score: 143.3 bits (360), Expect = 1.0e-34 Identity = 79/95 (83.16%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of IVF0015315 vs. TAIR 10
Match: AT1G56410.1 (heat shock protein 70 (Hsp 70) family protein ) HSP 1 Score: 141.7 bits (356), Expect = 2.9e-34 Identity = 77/95 (81.05%), Postives = 83/95 (87.37%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|