
IVF0015053 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGGTATTTTAATAGTAAGACTTTTTTTTTCAATTACTTTATCCCTCATTTGGGTTGTATTAGACTAAAGTGATGCTTTGTATTTGTAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA ATGGAATTTTTTCTCCTGAAGGCCCTTGATAGAGTTGTTGCATTGTTGAAAGTAGTCAGGCTAGCCACGGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTGCAAGATTGAGTAGATGTACTAAATTAATTACCGATGAAGATGGACCAATTCCAAGATGCAAACCTTTCAAGTACACATATGGAAAGAAGATAGTAATATATTTTATATTTTGGTCTCATAGCTCTAGAGCAAGTCTTGCATCATGTAGCTTATTTTGA MEFFLLKALDRVVALLKVVRLATGHNAIDMVGTILLNILRGDIARLSRCTKLITDEDGPIPRCKPFKYTYGKKIVIYFIFWSHSSRASLASCSLF Homology
BLAST of IVF0015053 vs. ExPASy Swiss-Prot
Match: O64862 (Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana OX=3702 GN=NCS6 PE=2 SV=2) HSP 1 Score: 111.3 bits (277), Expect = 6.0e-24 Identity = 55/77 (71.43%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy Swiss-Prot
Match: Q6Z6G6 (Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=NCS6 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.0e-23 Identity = 54/77 (70.13%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy Swiss-Prot
Match: Q05AW7 (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus laevis OX=8355 GN=ctu1 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.5e-18 Identity = 43/77 (55.84%), Postives = 55/77 (71.43%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy Swiss-Prot
Match: Q94480 (Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum OX=44689 GN=ctu1 PE=2 SV=2) HSP 1 Score: 90.1 bits (222), Expect = 1.4e-17 Identity = 42/77 (54.55%), Postives = 55/77 (71.43%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy Swiss-Prot
Match: Q5FW05 (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis OX=8364 GN=ctu1 PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.4e-17 Identity = 43/77 (55.84%), Postives = 54/77 (70.13%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy TrEMBL
Match: A0A5D3DAG6 (Cytoplasmic tRNA 2-thiolation protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold237G001430 PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 1.3e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy TrEMBL
Match: A0A5A7T9N6 (Cytoplasmic tRNA 2-thiolation protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold36G002520 PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 1.3e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy TrEMBL
Match: A0A5D3DQ85 (Cytoplasmic tRNA 2-thiolation protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold436G00490 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 1.9e-25 Identity = 62/67 (92.54%), Postives = 63/67 (94.03%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy TrEMBL
Match: A0A1S3BIV7 (cytoplasmic tRNA 2-thiolation protein 1-like OS=Cucumis melo OX=3656 GN=LOC103490070 PE=3 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 2.8e-24 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of IVF0015053 vs. ExPASy TrEMBL
Match: A0A3P6BH96 (Cytoplasmic tRNA 2-thiolation protein 1 OS=Brassica oleracea OX=3712 GN=NCS6 PE=3 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 3.1e-23 Identity = 62/84 (73.81%), Postives = 68/84 (80.95%), Query Frame = 0
BLAST of IVF0015053 vs. NCBI nr
Match: TYK20555.1 (cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 147 bits (371), Expect = 1.42e-41 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0015053 vs. NCBI nr
Match: KAA0038049.1 (cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 147 bits (371), Expect = 2.94e-41 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0015053 vs. NCBI nr
Match: TYK25841.1 (cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 123 bits (308), Expect = 8.33e-33 Identity = 62/67 (92.54%), Postives = 63/67 (94.03%), Query Frame = 0
BLAST of IVF0015053 vs. NCBI nr
Match: XP_008447661.1 (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis melo]) HSP 1 Score: 119 bits (299), Expect = 4.45e-32 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of IVF0015053 vs. NCBI nr
Match: KAE8652032.1 (hypothetical protein Csa_018735 [Cucumis sativus]) HSP 1 Score: 122 bits (307), Expect = 5.27e-30 Identity = 65/88 (73.86%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of IVF0015053 vs. TAIR 10
Match: AT2G44270.1 (repressor of lrx1 ) HSP 1 Score: 111.3 bits (277), Expect = 4.3e-25 Identity = 55/77 (71.43%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of IVF0015053 vs. TAIR 10
Match: AT1G76170.1 (2-thiocytidine tRNA biosynthesis protein, TtcA ) HSP 1 Score: 109.8 bits (273), Expect = 1.2e-24 Identity = 54/77 (70.13%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of IVF0015053 vs. TAIR 10
Match: AT2G44270.2 (repressor of lrx1 ) HSP 1 Score: 99.0 bits (245), Expect = 2.2e-21 Identity = 48/67 (71.64%), Postives = 54/67 (80.60%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|