IVF0012798 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCAAACTCATGCAAAGGTATATTATTATATCTTCAATATATACAAAAATTTAGCCTCTTTCTCTTTATCTTAATGGTTAGTTTTTATTTATTTGATGTGTGACACACAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGCAGAAATTGCAGTCAAAATTATAGAGAAACAAAATAGTTCGGTTAAAGCCATTGTCGTTGAAGAAGGATCTTCTGTCGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCGTCCACAAGAAGACCAATAACGTTACTAAGACCCCTCGCATCGGCTAA ATGCCAAACTCATGCAAAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGCAGAAATTGCAGTCAAAATTATAGAGAAACAAAATAGTTCGGTTAAAGCCATTGTCGTTGAAGAAGGATCTTCTGTCGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCGTCCACAAGAAGACCAATAACGTTACTAAGACCCCTCGCATCGGCTAA ATGCCAAACTCATGCAAAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGCAGAAATTGCAGTCAAAATTATAGAGAAACAAAATAGTTCGGTTAAAGCCATTGTCGTTGAAGAAGGATCTTCTGTCGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCGTCCACAAGAAGACCAATAACGTTACTAAGACCCCTCGCATCGGCTAA MPNSCKGKSSWPELVNAPAEIAVKIIEKQNSSVKAIVVEEGSSVVTNFECGRVFVFVHKKTNNVTKTPRIG Homology
BLAST of IVF0012798 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.5e-11 Identity = 34/69 (49.28%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 57.4 bits (137), Expect = 7.7e-08 Identity = 32/71 (45.07%), Postives = 44/71 (61.97%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.7e-08 Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy Swiss-Prot
Match: P24076 (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.0e-07 Identity = 28/69 (40.58%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.5e-06 Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy TrEMBL
Match: A0A5D3D0M4 (Inhibitor of trypsin and hageman factor-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001180 PE=3 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 3.0e-31 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy TrEMBL
Match: A0A0A0L593 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142950 PE=3 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 3.1e-28 Identity = 64/71 (90.14%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy TrEMBL
Match: A0A0A0L795 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 6.3e-13 Identity = 41/71 (57.75%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy TrEMBL
Match: A0A1S4DTF7 (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 3.1e-12 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of IVF0012798 vs. ExPASy TrEMBL
Match: A0A0A0L4J0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142970 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 7.0e-12 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of IVF0012798 vs. NCBI nr
Match: KAA0049293.1 (inhibitor of trypsin and hageman factor-like [Cucumis melo var. makuwa] >TYK17265.1 inhibitor of trypsin and hageman factor-like [Cucumis melo var. makuwa]) HSP 1 Score: 143 bits (360), Expect = 6.90e-43 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of IVF0012798 vs. NCBI nr
Match: KGN56903.1 (hypothetical protein Csa_010041 [Cucumis sativus]) HSP 1 Score: 133 bits (334), Expect = 6.42e-39 Identity = 64/71 (90.14%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of IVF0012798 vs. NCBI nr
Match: XP_004134090.1 (glu S.griseus protease inhibitor [Cucumis sativus]) HSP 1 Score: 82.4 bits (202), Expect = 8.80e-19 Identity = 41/71 (57.75%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of IVF0012798 vs. NCBI nr
Match: KAE8650342.1 (hypothetical protein Csa_009611 [Cucumis sativus]) HSP 1 Score: 82.4 bits (202), Expect = 4.79e-18 Identity = 41/71 (57.75%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of IVF0012798 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 80.1 bits (196), Expect = 7.23e-18 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of IVF0012798 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 56.6 bits (135), Expect = 9.3e-09 Identity = 30/71 (42.25%), Postives = 40/71 (56.34%), Query Frame = 0
BLAST of IVF0012798 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 53.9 bits (128), Expect = 6.1e-08 Identity = 28/65 (43.08%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of IVF0012798 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 46.6 bits (109), Expect = 9.7e-06 Identity = 24/65 (36.92%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of IVF0012798 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 46.6 bits (109), Expect = 9.7e-06 Identity = 24/65 (36.92%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of IVF0012798 vs. TAIR 10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 44.7 bits (104), Expect = 3.7e-05 Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|