
IVF0009605 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GCTCAGTGAAGCTCAATTATTATTGCATTAAGAAAGATCGTTGCTTTTCCTAAGCGGGTCTCTTCTTTCTCATTTTTGTTTACCACCATGGACATGAAGAAGGTGACCTGTGCCGTCCTTGTTGCGGCTGCCGCCGTGAGTGCTACCATGGCCACCAGTGAAGGGCCAGCTCCGGCACCCAGCCTGTCCTCCGATGCAACTGCTGCTTTGCCAGCTGTTGGAGCCTTCATTGGTGCTTCTCTCGTGTCTTTCTTTGCCTACTACTTGTAAGAAGTTGAGAAAAGAATAGGAGGGGTTGGGAGGAATACAGAGAAAAATGTTATGTAAACATGGGAAAGGGAAAGAGAAACTTGTTAAGCAGTGGTAGTGGTAATTGGTGTAGTTAATTTGGAAGAAGAAAATGAATGTTTATTTGAATTTGATTTCAATTTCATTGCTCAATGGGCAAAAACTTTTGAATTTGGTTTGATTATTTAATGAGCAAAATCTTGGTTGAATTATAGAAGTATATGTTTACTCTTTTGCTATTTTAATTGATTTGTTTGGAGA GCTCAGTGAAGCTCAATTATTATTGCATTAAGAAAGATCGTTGCTTTTCCTAAGCGGGTCTCTTCTTTCTCATTTTTGTTTACCACCATGGACATGAAGAAGGTGACCTGTGCCGTCCTTGTTGCGGCTGCCGCCGTGAGTGCTACCATGGCCACCAGTGAAGGGCCAGCTCCGGCACCCAGCCTGTCCTCCGATGCAACTGCTGCTTTGCCAGCTGTTGGAGCCTTCATTGGTGCTTCTCTCGTGTCTTTCTTTGCCTACTACTTGTAAGAAGTTGAGAAAAGAATAGGAGGGGTTGGGAGGAATACAGAGAAAAATGTTATGTAAACATGGGAAAGGGAAAGAGAAACTTGTTAAGCAGTGGTAGTGGTAATTGGTGTAGTTAATTTGGAAGAAGAAAATGAATGTTTATTTGAATTTGATTTCAATTTCATTGCTCAATGGGCAAAAACTTTTGAATTTGGTTTGATTATTTAATGAGCAAAATCTTGGTTGAATTATAGAAGTATATGTTTACTCTTTTGCTATTTTAATTGATTTGTTTGGAGA ATGGACATGAAGAAGGTGACCTGTGCCGTCCTTGTTGCGGCTGCCGCCGTGAGTGCTACCATGGCCACCAGTGAAGGGCCAGCTCCGGCACCCAGCCTGTCCTCCGATGCAACTGCTGCTTTGCCAGCTGTTGGAGCCTTCATTGGTGCTTCTCTCGTGTCTTTCTTTGCCTACTACTTGTAA MDMKKVTCAVLVAAAAVSATMATSEGPAPAPSLSSDATAALPAVGAFIGASLVSFFAYYL Homology
BLAST of IVF0009605 vs. ExPASy Swiss-Prot
Match: Q8S2W4 (Arabinogalactan protein 23 OS=Arabidopsis thaliana OX=3702 GN=AGP23 PE=1 SV=2) HSP 1 Score: 61.6 bits (148), Expect = 3.5e-09 Identity = 36/60 (60.00%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of IVF0009605 vs. ExPASy TrEMBL
Match: A0A5D3DQ83 (Arabinogalactan peptide 23 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G005730 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 3.8e-19 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of IVF0009605 vs. ExPASy TrEMBL
Match: A0A068UH44 (Uncharacterized protein OS=Coffea canephora OX=49390 GN=GSCOC_T00025121001 PE=4 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 2.5e-10 Identity = 41/60 (68.33%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of IVF0009605 vs. ExPASy TrEMBL
Match: A0A6P6W2Y2 (arabinogalactan protein 23-like OS=Coffea arabica OX=13443 GN=LOC113729764 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 4.2e-10 Identity = 41/60 (68.33%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of IVF0009605 vs. ExPASy TrEMBL
Match: A0A6P6W4D1 (arabinogalactan protein 23-like OS=Coffea arabica OX=13443 GN=LOC113729765 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 5.5e-10 Identity = 41/59 (69.49%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of IVF0009605 vs. ExPASy TrEMBL
Match: A0A059DIY4 (Uncharacterized protein (Fragment) OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_A02403 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 7.2e-10 Identity = 40/60 (66.67%), Postives = 51/60 (85.00%), Query Frame = 0
BLAST of IVF0009605 vs. NCBI nr
Match: KAA0043704.1 (Arabinogalactan peptide 23 [Cucumis melo var. makuwa] >TYK25430.1 Arabinogalactan peptide 23 [Cucumis melo var. makuwa]) HSP 1 Score: 102 bits (253), Expect = 6.95e-27 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of IVF0009605 vs. NCBI nr
Match: XP_038906349.1 (arabinogalactan protein 23 [Benincasa hispida]) HSP 1 Score: 85.5 bits (210), Expect = 2.61e-20 Identity = 52/61 (85.25%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of IVF0009605 vs. NCBI nr
Match: CDP07756.1 (unnamed protein product [Coffea canephora]) HSP 1 Score: 72.8 bits (177), Expect = 2.82e-15 Identity = 41/60 (68.33%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of IVF0009605 vs. NCBI nr
Match: XP_027109799.1 (arabinogalactan protein 23-like [Coffea arabica] >XP_027109801.1 arabinogalactan protein 23-like [Coffea arabica] >XP_027159544.1 arabinogalactan protein 23-like [Coffea eugenioides] >XP_027159545.1 arabinogalactan protein 23-like [Coffea eugenioides] >XP_027159547.1 arabinogalactan protein 23-like [Coffea eugenioides]) HSP 1 Score: 72.0 bits (175), Expect = 5.69e-15 Identity = 41/60 (68.33%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of IVF0009605 vs. NCBI nr
Match: XP_027109800.1 (arabinogalactan protein 23-like [Coffea arabica] >XP_027159540.1 arabinogalactan protein 23-like [Coffea eugenioides] >XP_027159546.1 arabinogalactan protein 23-like [Coffea eugenioides]) HSP 1 Score: 71.6 bits (174), Expect = 8.09e-15 Identity = 41/59 (69.49%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of IVF0009605 vs. TAIR 10
Match: AT3G57690.1 (arabinogalactan protein 23 ) HSP 1 Score: 61.6 bits (148), Expect = 2.5e-10 Identity = 36/60 (60.00%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of IVF0009605 vs. TAIR 10
Match: AT2G41905.1 (BEST Arabidopsis thaliana protein match is: arabinogalactan protein 23 (TAIR:AT3G57690.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 54.3 bits (129), Expect = 3.9e-08 Identity = 34/61 (55.74%), Postives = 47/61 (77.05%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|