IVF0009185 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGAATTTGTCAACGGTGTCAAAGGAATAACCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATGCCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCAATCATGGATATTCCAGTAAGAAAGGTTATGCTCGGGCGTATGGTCGGTGCCTTGGGAGCACCCATTGATGGAAAAGGGGCTTTCAGCGATCATAAGCGAAGACGTATCAAAGTGAAAGCCCTTGAGATTATTGAATGTAAATCAGTGCACGAGCCTATGAAAATAGGGTTAAAAGTAGTGGATATCCTGTTCCAATAG ATGGTAGAATTTGTCAACGGTGTCAAAGGAATAACCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATGCCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCAATCATGGATATTCCAGTAAGAAAGGTTATGCTCGGGCGTATGGTCGGTGCCTTGGGAGCACCCATTGATGGAAAAGGGGCTTTCAGCGATCATAAGCGAAGACGTATCAAAGTGAAAGCCCTTGAGATTATTGAATGTAAATCAGTGCACGAGCCTATGAAAATAGGGTTAAAAGTAGTGGATATCCTGTTCCAATAG ATGGTAGAATTTGTCAACGGTGTCAAAGGAATAACCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATGCCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCAATCATGGATATTCCAGTAAGAAAGGTTATGCTCGGGCGTATGGTCGGTGCCTTGGGAGCACCCATTGATGGAAAAGGGGCTTTCAGCGATCATAAGCGAAGACGTATCAAAGTGAAAGCCCTTGAGATTATTGAATGTAAATCAGTGCACGAGCCTATGAAAATAGGGTTAAAAGTAGTGGATATCCTGTTCCAATAG MVEFVNGVKGITLNLENENVGIVVFGSDAAIKEGDLVKRTGSIMDIPVRKVMLGRMVGALGAPIDGKGAFSDHKRRRIKVKALEIIECKSVHEPMKIGLKVVDILFQ Homology
BLAST of IVF0009185 vs. ExPASy Swiss-Prot
Match: P05494 (ATP synthase subunit alpha, mitochondrial OS=Zea mays OX=4577 GN=ATPA PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.4e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy Swiss-Prot
Match: P0C520 (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa OX=4530 GN=ATPA PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.4e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy Swiss-Prot
Match: P0C521 (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=ATPA PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.4e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy Swiss-Prot
Match: P0C522 (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=ATPA PE=1 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.4e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy Swiss-Prot
Match: P12862 (ATP synthase subunit alpha, mitochondrial OS=Triticum aestivum OX=4565 GN=ATPA PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.4e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy TrEMBL
Match: A0A5A7U9C2 (ATPase subunit 1 (Mitochondrion) OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold60G004080 PE=3 SV=1) HSP 1 Score: 209.5 bits (532), Expect = 6.8e-51 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy TrEMBL
Match: A0A5D3CP90 (ATPase subunit 1 (Mitochondrion) OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold769G00030 PE=3 SV=1) HSP 1 Score: 207.6 bits (527), Expect = 2.6e-50 Identity = 106/107 (99.07%), Postives = 106/107 (99.07%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy TrEMBL
Match: A0A5A7UCL8 (ATPase subunit 1 (Mitochondrion) OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold769G00010 PE=3 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 2.0e-39 Identity = 90/105 (85.71%), Postives = 94/105 (89.52%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy TrEMBL
Match: A0A3B6ING1 (ATP-synt_ab_N domain-containing protein OS=Triticum aestivum OX=4565 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 2.3e-38 Identity = 84/105 (80.00%), Postives = 91/105 (86.67%), Query Frame = 0
BLAST of IVF0009185 vs. ExPASy TrEMBL
Match: A0A5A7UEG9 (ATPase subunit 1 (Mitochondrion) OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold769G00160 PE=3 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 1.5e-37 Identity = 86/104 (82.69%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of IVF0009185 vs. NCBI nr
Match: KAA0051944.1 (ATPase subunit 1 [Cucumis melo var. makuwa]) HSP 1 Score: 208 bits (530), Expect = 1.06e-67 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 0
BLAST of IVF0009185 vs. NCBI nr
Match: TYK12216.1 (ATPase subunit 1 [Cucumis melo var. makuwa]) HSP 1 Score: 206 bits (525), Expect = 6.12e-67 Identity = 106/107 (99.07%), Postives = 106/107 (99.07%), Query Frame = 0
BLAST of IVF0009185 vs. NCBI nr
Match: KAA0051946.1 (ATPase subunit 1 [Cucumis melo var. makuwa] >TYK12214.1 ATPase subunit 1 [Cucumis melo var. makuwa]) HSP 1 Score: 170 bits (431), Expect = 2.38e-51 Identity = 90/105 (85.71%), Postives = 94/105 (89.52%), Query Frame = 0
BLAST of IVF0009185 vs. NCBI nr
Match: KAF7048695.1 (hypothetical protein CFC21_057398 [Triticum aestivum] >KAF7048698.1 hypothetical protein CFC21_057401 [Triticum aestivum] >KAF7048701.1 hypothetical protein CFC21_057404 [Triticum aestivum]) HSP 1 Score: 167 bits (422), Expect = 1.14e-50 Identity = 84/105 (80.00%), Postives = 91/105 (86.67%), Query Frame = 0
BLAST of IVF0009185 vs. NCBI nr
Match: KAA0051941.1 (ATPase subunit 1 [Cucumis melo var. makuwa] >TYK12218.1 ATPase subunit 1 [Cucumis melo var. makuwa]) HSP 1 Score: 164 bits (415), Expect = 5.02e-49 Identity = 86/104 (82.69%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of IVF0009185 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 154.8 bits (390), Expect = 3.8e-38 Identity = 77/105 (73.33%), Postives = 88/105 (83.81%), Query Frame = 0
BLAST of IVF0009185 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 154.8 bits (390), Expect = 3.8e-38 Identity = 77/105 (73.33%), Postives = 88/105 (83.81%), Query Frame = 0
BLAST of IVF0009185 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 93.6 bits (231), Expect = 1.0e-19 Identity = 49/103 (47.57%), Postives = 65/103 (63.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|