IVF0006805 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTTGAATCCTAAGATTTTGGGATTGGCTCCTAAGGTTGCATATGTTTGGGGTTGCTTTCCTTTTCAATTGGTTTGAACTCCATCCAGACTCTTACCCATTTAGCTCCTTTGAGTTTTTTTGTTGATATTGTTGACCTTGGAGCTATGGTAGTGGTGGTGATTAAAGATGTTTTGATTATCTTCAAGCAGAACCCCTTTGTGGAGGCTTTTGAGGGATTTCTGTGTTCTTTTATGGAATGGGTGTGTCTGTCTATGCAAGGTATTGGGATGGTGTTGCCTTTAGAATCCTAAAAAGGACAAAGAGAAATTTGGGAGAGTCTTGGGTTTGTCCGTGGTTTTCATTACTGTTTTATATAGAGCATTTGGAACTCTTGGCTATTTTGCTTTTGGCAAAGATACTAAAGACATGATCACTAGTAACTTGGGCCCTGGATTATTAGCATCATTGCTAAACTGGGTCTCTATATAA ATGGATTTGAATCCTAAGATTTTGGGATTGGCTCCTAAGGTTGCATATGTTTGGGCTCCTTTGAGTTTTTTTGTTGATATTGTTGACCTTGGAGCTATGGTAGTGGTGGTGATTAAAGATGTTTTGATTATCTTCAAGCAGAACCCCTTTGTGGAGGCTTTTGAGGGATTTCTGTGTTCTTTTATGGAATGGAATCCTAAAAAGGACAAAGAGAAATTTGGGAGAGTCTTGGGTTTGTCCGTGGTTTTCATTACTGTTTTATATAGAGCATTTGGAACTCTTGGCTATTTTGCTTTTGGCAAAGATACTAAAGACATGATCACTAGTAACTTGGGCCCTGGATTATTAGCATCATTGCTAAACTGGGTCTCTATATAA ATGGATTTGAATCCTAAGATTTTGGGATTGGCTCCTAAGGTTGCATATGTTTGGGCTCCTTTGAGTTTTTTTGTTGATATTGTTGACCTTGGAGCTATGGTAGTGGTGGTGATTAAAGATGTTTTGATTATCTTCAAGCAGAACCCCTTTGTGGAGGCTTTTGAGGGATTTCTGTGTTCTTTTATGGAATGGAATCCTAAAAAGGACAAAGAGAAATTTGGGAGAGTCTTGGGTTTGTCCGTGGTTTTCATTACTGTTTTATATAGAGCATTTGGAACTCTTGGCTATTTTGCTTTTGGCAAAGATACTAAAGACATGATCACTAGTAACTTGGGCCCTGGATTATTAGCATCATTGCTAAACTGGGTCTCTATATAA MDLNPKILGLAPKVAYVWAPLSFFVDIVDLGAMVVVVIKDVLIIFKQNPFVEAFEGFLCSFMEWNPKKDKEKFGRVLGLSVVFITVLYRAFGTLGYFAFGKDTKDMITSNLGPGLLASLLNWVSI Homology
BLAST of IVF0006805 vs. ExPASy Swiss-Prot
Match: F4ILY9 (Amino acid transporter AVT3B OS=Arabidopsis thaliana OX=3702 GN=AVT3B PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.1e-22 Identity = 61/149 (40.94%), Postives = 84/149 (56.38%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy Swiss-Prot
Match: Q9SVG0 (Amino acid transporter AVT3C OS=Arabidopsis thaliana OX=3702 GN=AVT3C PE=1 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.3e-22 Identity = 65/154 (42.21%), Postives = 90/154 (58.44%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy Swiss-Prot
Match: Q9FKY3 (Amino acid transporter AVT3A OS=Arabidopsis thaliana OX=3702 GN=AVT3A PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.4e-17 Identity = 57/149 (38.26%), Postives = 80/149 (53.69%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy Swiss-Prot
Match: Q9SF09 (Amino acid transporter ANT1 OS=Arabidopsis thaliana OX=3702 GN=ANT1 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 7.5e-06 Identity = 36/114 (31.58%), Postives = 56/114 (49.12%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy Swiss-Prot
Match: Q924A5 (Proton-coupled amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc36a1 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 7.5e-06 Identity = 37/103 (35.92%), Postives = 51/103 (49.51%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy TrEMBL
Match: A0A5A7U0U9 (Amino acid transporter ANTL1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold133G00940 PE=3 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 4.5e-38 Identity = 94/155 (60.65%), Postives = 105/155 (67.74%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy TrEMBL
Match: A0A5D3CW42 (Amino acid transporter ANTL1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1275G00330 PE=3 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 3.8e-37 Identity = 93/155 (60.00%), Postives = 104/155 (67.10%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy TrEMBL
Match: A0A1S3BJZ8 (amino acid transporter ANTL1-like OS=Cucumis melo OX=3656 GN=LOC103490455 PE=3 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 3.8e-37 Identity = 93/155 (60.00%), Postives = 104/155 (67.10%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy TrEMBL
Match: A0A0A0KFY3 (Aa_trans domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G118340 PE=3 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 3.2e-36 Identity = 91/155 (58.71%), Postives = 101/155 (65.16%), Query Frame = 0
BLAST of IVF0006805 vs. ExPASy TrEMBL
Match: A0A6J1I4K1 (amino acid transporter AVT3B-like OS=Cucurbita maxima OX=3661 GN=LOC111469813 PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 2.3e-34 Identity = 87/155 (56.13%), Postives = 102/155 (65.81%), Query Frame = 0
BLAST of IVF0006805 vs. NCBI nr
Match: KAA0047837.1 (amino acid transporter ANTL1-like [Cucumis melo var. makuwa]) HSP 1 Score: 166 bits (419), Expect = 1.12e-46 Identity = 94/155 (60.65%), Postives = 105/155 (67.74%), Query Frame = 0
BLAST of IVF0006805 vs. NCBI nr
Match: XP_038876664.1 (amino acid transporter AVT3B-like [Benincasa hispida]) HSP 1 Score: 164 bits (414), Expect = 6.15e-46 Identity = 93/155 (60.00%), Postives = 105/155 (67.74%), Query Frame = 0
BLAST of IVF0006805 vs. NCBI nr
Match: XP_008448189.1 (PREDICTED: amino acid transporter ANTL1-like [Cucumis melo] >TYK14636.1 amino acid transporter ANTL1-like [Cucumis melo var. makuwa]) HSP 1 Score: 162 bits (411), Expect = 1.71e-45 Identity = 93/155 (60.00%), Postives = 104/155 (67.10%), Query Frame = 0
BLAST of IVF0006805 vs. NCBI nr
Match: KAE8646825.1 (hypothetical protein Csa_005387 [Cucumis sativus]) HSP 1 Score: 159 bits (403), Expect = 2.01e-44 Identity = 91/155 (58.71%), Postives = 101/155 (65.16%), Query Frame = 0
BLAST of IVF0006805 vs. NCBI nr
Match: XP_004139971.1 (amino acid transporter AVT3B [Cucumis sativus]) HSP 1 Score: 159 bits (403), Expect = 2.60e-44 Identity = 91/155 (58.71%), Postives = 101/155 (65.16%), Query Frame = 0
BLAST of IVF0006805 vs. TAIR 10
Match: AT2G42005.1 (Transmembrane amino acid transporter family protein ) HSP 1 Score: 107.5 bits (267), Expect = 8.1e-24 Identity = 61/149 (40.94%), Postives = 84/149 (56.38%), Query Frame = 0
BLAST of IVF0006805 vs. TAIR 10
Match: AT4G38250.1 (Transmembrane amino acid transporter family protein ) HSP 1 Score: 105.9 bits (263), Expect = 2.4e-23 Identity = 65/154 (42.21%), Postives = 90/154 (58.44%), Query Frame = 0
BLAST of IVF0006805 vs. TAIR 10
Match: AT5G65990.1 (Transmembrane amino acid transporter family protein ) HSP 1 Score: 90.5 bits (223), Expect = 1.0e-18 Identity = 57/149 (38.26%), Postives = 80/149 (53.69%), Query Frame = 0
BLAST of IVF0006805 vs. TAIR 10
Match: AT3G11900.1 (aromatic and neutral transporter 1 ) HSP 1 Score: 51.6 bits (122), Expect = 5.3e-07 Identity = 36/114 (31.58%), Postives = 56/114 (49.12%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|