IVF0004752 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCATATCACAAGACTTTTAGAATCAAGAAGACACAAAATTTTAGAATCATGAAGAAGCTTGCAAAGAAGATAAGGCAGAATAGGCCGATCACACACTGGATTTGCCTGAGAAATGACAATACAATCATATATGACGCAAAACGCAGACACTAG ATGTCATATCACAAGACTTTTAGAATCAAGAAGACACAAAATTTTAGAATCATGAAGAAGCTTGCAAAGAAGATAAGGCAGAATAGGCCGATCACACACTGGATTTGCCTGAGAAATGACAATACAATCATATATGACGCAAAACGCAGACACTAG ATGTCATATCACAAGACTTTTAGAATCAAGAAGACACAAAATTTTAGAATCATGAAGAAGCTTGCAAAGAAGATAAGGCAGAATAGGCCGATCACACACTGGATTTGCCTGAGAAATGACAATACAATCATATATGACGCAAAACGCAGACACTAG MSYHKTFRIKKTQNFRIMKKLAKKIRQNRPITHWICLRNDNTIIYDAKRRH Homology
BLAST of IVF0004752 vs. ExPASy Swiss-Prot
Match: Q6KAJ8 (60S ribosomal protein L39-1 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39A PE=3 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 1.0e-09 Identity = 33/51 (64.71%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy Swiss-Prot
Match: P51426 (60S ribosomal protein L39-2 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39B PE=3 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 1.0e-09 Identity = 33/51 (64.71%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy Swiss-Prot
Match: P51425 (60S ribosomal protein L39 OS=Zea mays OX=4577 GN=RPL39 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.0e-09 Identity = 33/51 (64.71%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy Swiss-Prot
Match: Q5SMI4 (60S ribosomal protein L39-3 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39C PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 2.9e-09 Identity = 32/51 (62.75%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy Swiss-Prot
Match: P51424 (60S ribosomal protein L39-1 OS=Arabidopsis thaliana OX=3702 GN=RPL39A PE=3 SV=2) HSP 1 Score: 60.8 bits (146), Expect = 5.0e-09 Identity = 32/51 (62.75%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy TrEMBL
Match: A0A6J1HZ80 (60S ribosomal protein L39 OS=Cucurbita maxima OX=3661 GN=LOC111467947 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 4.4e-08 Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy TrEMBL
Match: A0A0A0LYE1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G568530 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 4.4e-08 Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy TrEMBL
Match: A0A1S3BCZ7 (60S ribosomal protein L39 OS=Cucumis melo OX=3656 GN=LOC103488337 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 4.4e-08 Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy TrEMBL
Match: A0A6J1C1Z7 (60S ribosomal protein L39 OS=Momordica charantia OX=3673 GN=LOC111007536 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 4.4e-08 Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. ExPASy TrEMBL
Match: A0A6J1F9G6 (60S ribosomal protein L39 OS=Cucurbita moschata OX=3662 GN=LOC111443316 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 4.4e-08 Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. NCBI nr
Match: XP_004135586.1 (60S ribosomal protein L39 [Cucumis sativus] >XP_004145516.1 60S ribosomal protein L39 [Cucumis sativus] >XP_008445252.1 PREDICTED: 60S ribosomal protein L39 [Cucumis melo] >XP_008450567.1 PREDICTED: 60S ribosomal protein L39 [Cucumis melo] >XP_008450568.1 PREDICTED: 60S ribosomal protein L39 [Cucumis melo] >XP_008452877.1 PREDICTED: 60S ribosomal protein L39 [Cucumis melo] >XP_010089945.2 60S ribosomal protein L39 [Morus notabilis] >XP_010519648.1 PREDICTED: 60S ribosomal protein L39 [Tarenaya hassleriana] >XP_010525935.1 PREDICTED: 60S ribosomal protein L39 [Tarenaya hassleriana] >XP_010526234.1 PREDICTED: 60S ribosomal protein L39 isoform X1 [Tarenaya hassleriana] >XP_010526235.1 PREDICTED: 60S ribosomal protein L39 isoform X2 [Tarenaya hassleriana] >XP_010540302.1 PREDICTED: 60S ribosomal protein L39 [Tarenaya hassleriana] >XP_010541585.1 PREDICTED: 60S ribosomal protein L39 [Tarenaya hassleriana] >XP_010546538.1 PREDICTED: 60S ribosomal protein L39 [Tarenaya hassleriana] >XP_011649840.1 60S ribosomal protein L39 [Cucumis sativus] >XP_011659662.1 60S ribosomal protein L39 [Cucumis sativus] >XP_022135628.1 60S ribosomal protein L39 [Momordica charantia] >XP_022135629.1 60S ribosomal protein L39 [Momordica charantia] >XP_022149767.1 60S ribosomal protein L39 [Momordica charantia] >XP_022931559.1 60S ribosomal protein L39 [Cucurbita moschata] >XP_022931560.1 60S ribosomal protein L39 [Cucurbita moschata] >XP_022931561.1 60S ribosomal protein L39 [Cucurbita moschata] >XP_022936854.1 60S ribosomal protein L39 [Cucurbita moschata] >XP_022941352.1 60S ribosomal protein L39 [Cucurbita moschata] >XP_022951697.1 60S ribosomal protein L39 [Cucurbita moschata] >XP_022968828.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_022968829.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_022976223.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_022981083.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_022989496.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_022989497.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_022989498.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_022996633.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_023002567.1 60S ribosomal protein L39 [Cucurbita maxima] >XP_023525759.1 60S ribosomal protein L39 [Cucurbita pepo subsp. pepo] >XP_023530147.1 60S ribosomal protein L39 [Cucurbita pepo subsp. pepo] >XP_023530148.1 60S ribosomal protein L39 [Cucurbita pepo subsp. pepo] >XP_023530149.1 60S ribosomal protein L39 [Cucurbita pepo subsp. pepo] >XP_023536041.1 60S ribosomal protein L39 [Cucurbita pepo subsp. pepo] >XP_023538028.1 60S ribosomal protein L39 [Cucurbita pepo subsp. pepo] >XP_023545687.1 60S ribosomal protein L39 [Cucurbita pepo subsp. pepo] >XP_024025856.1 60S ribosomal protein L39 [Morus notabilis] >XP_038879780.1 60S ribosomal protein L39 [Benincasa hispida] >XP_038879781.1 60S ribosomal protein L39 [Benincasa hispida] >XP_038885636.1 60S ribosomal protein L39 [Benincasa hispida] >XP_038897324.1 60S ribosomal protein L39 [Benincasa hispida] >XP_042400677.1 60S ribosomal protein L39 [Zingiber officinale] >XP_042457171.1 60S ribosomal protein L39 [Zingiber officinale] >XP_042462462.1 60S ribosomal protein L39 [Zingiber officinale] >KAA0064602.1 60S ribosomal protein L39 [Cucumis melo var. makuwa] >PON38089.1 Ribosomal protein [Parasponia andersonii] >PON99195.1 Ribosomal protein [Trema orientale] >KGN55452.1 hypothetical protein Csa_012406 [Cucumis sativus] >KGN66024.1 hypothetical protein Csa_007311 [Cucumis sativus]) HSP 1 Score: 64.7 bits (156), Expect = 2.45e-12 Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. NCBI nr
Match: XP_020246471.1 (60S ribosomal protein L39-1-like [Asparagus officinalis]) HSP 1 Score: 64.3 bits (155), Expect = 3.48e-12 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 0
BLAST of IVF0004752 vs. NCBI nr
Match: PON37200.1 (Ribosomal protein [Trema orientale] >PON38027.1 Ribosomal protein [Parasponia andersonii]) HSP 1 Score: 64.7 bits (156), Expect = 3.96e-12 Identity = 35/51 (68.63%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. NCBI nr
Match: ABR17261.1 (unknown [Picea sitchensis]) HSP 1 Score: 63.9 bits (154), Expect = 4.94e-12 Identity = 34/51 (66.67%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. NCBI nr
Match: XP_002309322.1 (60S ribosomal protein L39 isoform X6 [Populus trichocarpa] >XP_002324563.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_008242931.1 PREDICTED: 60S ribosomal protein L39 [Prunus mume] >XP_008776220.1 60S ribosomal protein L39 [Phoenix dactylifera] >XP_008784792.1 60S ribosomal protein L39 [Phoenix dactylifera] >XP_008806299.1 60S ribosomal protein L39 [Phoenix dactylifera] >XP_009392151.1 PREDICTED: 60S ribosomal protein L39 [Musa acuminata subsp. malaccensis] >XP_009401451.1 PREDICTED: 60S ribosomal protein L39 [Musa acuminata subsp. malaccensis] >XP_009410183.1 PREDICTED: 60S ribosomal protein L39 [Musa acuminata subsp. malaccensis] >XP_009417442.1 PREDICTED: 60S ribosomal protein L39 [Musa acuminata subsp. malaccensis] >XP_010044411.1 60S ribosomal protein L39 [Eucalyptus grandis] >XP_010048914.1 60S ribosomal protein L39 [Eucalyptus grandis] >XP_010245545.1 PREDICTED: 60S ribosomal protein L39 [Nelumbo nucifera] >XP_010258004.1 PREDICTED: 60S ribosomal protein L39 [Nelumbo nucifera] >XP_010260434.1 PREDICTED: 60S ribosomal protein L39 [Nelumbo nucifera] >XP_010265684.1 PREDICTED: 60S ribosomal protein L39 [Nelumbo nucifera] >XP_011017966.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011036646.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011039599.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011039601.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011039602.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011039603.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011039604.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011039605.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011039606.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_011039607.1 PREDICTED: 60S ribosomal protein L39 [Populus euphratica] >XP_019709046.1 60S ribosomal protein L39 [Elaeis guineensis] >XP_020099707.1 60S ribosomal protein L39 [Ananas comosus] >XP_020265700.1 60S ribosomal protein L39 [Asparagus officinalis] >XP_020270327.1 60S ribosomal protein L39 [Asparagus officinalis] >XP_020424819.1 60S ribosomal protein L39 [Prunus persica] >XP_021809045.1 60S ribosomal protein L39 [Prunus avium] >XP_024445771.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_024448991.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_024448992.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_024448993.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_024448994.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_024459104.1 60S ribosomal protein L39 isoform X6 [Populus trichocarpa] >XP_024459105.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_024459106.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_024459107.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_024459979.1 60S ribosomal protein L39 [Populus trichocarpa] >XP_030449231.1 60S ribosomal protein L39 [Syzygium oleosum] >XP_030452772.1 60S ribosomal protein L39 [Syzygium oleosum] >XP_031378866.1 60S ribosomal protein L39 [Punica granatum] >XP_031389311.1 60S ribosomal protein L39 [Punica granatum] >XP_034225079.1 60S ribosomal protein L39 [Prunus dulcis] >XP_034895466.1 60S ribosomal protein L39 [Populus alba] >XP_034896723.1 60S ribosomal protein L39 [Populus alba] >XP_034896724.1 60S ribosomal protein L39 [Populus alba] >XP_034907744.1 60S ribosomal protein L39 [Populus alba] >XP_034916411.1 60S ribosomal protein L39 isoform X1 [Populus alba] >XP_034916412.1 60S ribosomal protein L39 isoform X2 [Populus alba] >XP_034917532.1 60S ribosomal protein L39 [Populus alba] >XP_038695055.1 60S ribosomal protein L39 [Tripterygium wilfordii] >XP_038696106.1 60S ribosomal protein L39 [Tripterygium wilfordii] >XP_038696107.1 60S ribosomal protein L39 [Tripterygium wilfordii] >XP_038700232.1 60S ribosomal protein L39 [Tripterygium wilfordii] >XP_038700668.1 60S ribosomal protein L39 [Tripterygium wilfordii] >XP_038710692.1 60S ribosomal protein L39 [Tripterygium wilfordii] >APR63713.1 60S ribosomal protein-like L39 [Populus tomentosa] >KAB5552815.1 hypothetical protein DKX38_010126 [Salix brachista] >KAF8035846.1 hypothetical protein BT93_C1769 [Corymbia citriodora subsp. variegata] >MBO8631045.1 50S ribosomal protein L39e [Staphylococcus aureus] >RWW18957.1 hypothetical protein GW17_00017032 [Ensete ventricosum] >THU58292.1 hypothetical protein C4D60_Mb03t12650 [Musa balbisiana] >CAB4288805.1 unnamed protein product [Prunus armeniaca]) HSP 1 Score: 63.9 bits (154), Expect = 4.94e-12 Identity = 34/51 (66.67%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of IVF0004752 vs. TAIR 10
Match: AT4G31985.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 60.8 bits (146), Expect = 3.6e-10 Identity = 32/51 (62.75%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of IVF0004752 vs. TAIR 10
Match: AT2G25210.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 58.5 bits (140), Expect = 1.8e-09 Identity = 27/35 (77.14%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of IVF0004752 vs. TAIR 10
Match: AT3G02190.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-08 Identity = 30/51 (58.82%), Postives = 34/51 (66.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|