IVF0003738 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCAGAGATGGCATTGAAATCCCTCCCTCTTCTCACGACATTCTTAAATTTAATATAATCGCCACACTTAATTCATCAGATCAACCCGCCCCACCTTCTGTTCAGCCAGATATCATTCAACCGGACAGCACCAAACTTAAATTCCCTCCACCTGAGGCTCTCAAGAGTGAGTAGAGATATTTTTGTATTAAGAAGTACTTGTTTTTACATAACAATCATTGATTTTTAATTTGATTATATTTTAATTGTTTCCAGGAGACAAGTTTCTTTGGCTGAGTGATGGTGAATTTGCAAGACAAACACTTGCTGGTCTCAACCCTTATTGTATACAGTTGGTCAAGGTGAGTGACACTTTTGAAAAGTTATGCCAATCATAA ATGTTCAGAGATGGCATTGAAATCCCTCCCTCTTCTCACGACATTCTTAAATTTAATATAATCGCCACACTTAATTCATCAGATCAACCCGCCCCACCTTCTGTTCAGCCAGATATCATTCAACCGGACAGCACCAAACTTAAATTCCCTCCACCTGAGGCTCTCAAGAGAGACAAGTTTCTTTGGCTGAGTGATGGTGAATTTGCAAGACAAACACTTGCTGGTCTCAACCCTTATTGTATACAGTTGGTCAAGGTGAGTGACACTTTTGAAAAGTTATGCCAATCATAA ATGTTCAGAGATGGCATTGAAATCCCTCCCTCTTCTCACGACATTCTTAAATTTAATATAATCGCCACACTTAATTCATCAGATCAACCCGCCCCACCTTCTGTTCAGCCAGATATCATTCAACCGGACAGCACCAAACTTAAATTCCCTCCACCTGAGGCTCTCAAGAGAGACAAGTTTCTTTGGCTGAGTGATGGTGAATTTGCAAGACAAACACTTGCTGGTCTCAACCCTTATTGTATACAGTTGGTCAAGGTGAGTGACACTTTTGAAAAGTTATGCCAATCATAA MFRDGIEIPPSSHDILKFNIIATLNSSDQPAPPSVQPDIIQPDSTKLKFPPPEALKRDKFLWLSDGEFARQTLAGLNPYCIQLVKVSDTFEKLCQS Homology
BLAST of IVF0003738 vs. ExPASy Swiss-Prot
Match: Q8GSM2 (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare OX=4513 GN=LOX2.3 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.5e-10 Identity = 37/86 (43.02%), Postives = 49/86 (56.98%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy Swiss-Prot
Match: P38418 (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LOX2 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.2e-09 Identity = 39/94 (41.49%), Postives = 50/94 (53.19%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy Swiss-Prot
Match: P38419 (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CM-LOX1 PE=2 SV=2) HSP 1 Score: 60.8 bits (146), Expect = 9.4e-09 Identity = 32/85 (37.65%), Postives = 47/85 (55.29%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy Swiss-Prot
Match: Q06327 (Linoleate 9S-lipoxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=LOX1 PE=1 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 4.7e-08 Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy Swiss-Prot
Match: P38417 (Linoleate 9S-lipoxygenase-4 OS=Glycine max OX=3847 GN=LOX1.5 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 8.0e-08 Identity = 29/82 (35.37%), Postives = 48/82 (58.54%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy TrEMBL
Match: A0A5A7TEK5 (Lipoxygenase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold206G00130 PE=3 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 2.0e-41 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy TrEMBL
Match: A0A5D3DE91 (Lipoxygenase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold859G00110 PE=3 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 2.0e-41 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy TrEMBL
Match: A0A0A0KWX7 (Lipoxygenase domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G286980 PE=4 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 3.5e-38 Identity = 84/90 (93.33%), Postives = 87/90 (96.67%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy TrEMBL
Match: A0A5A7TDJ5 (Lipoxygenase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold206G00150 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 8.5e-37 Identity = 78/85 (91.76%), Postives = 81/85 (95.29%), Query Frame = 0
BLAST of IVF0003738 vs. ExPASy TrEMBL
Match: A0A0A0L1U9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G286940 PE=4 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 1.0e-29 Identity = 62/91 (68.13%), Postives = 77/91 (84.62%), Query Frame = 0
BLAST of IVF0003738 vs. NCBI nr
Match: TYK21649.1 (linoleate 13S-lipoxygenase 2-1 [Cucumis melo var. makuwa]) HSP 1 Score: 176 bits (447), Expect = 5.57e-49 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of IVF0003738 vs. NCBI nr
Match: KAA0041368.1 (linoleate 13S-lipoxygenase 2-1 [Cucumis melo var. makuwa]) HSP 1 Score: 176 bits (447), Expect = 5.57e-49 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of IVF0003738 vs. NCBI nr
Match: KAA0041370.1 (linoleate 13S-lipoxygenase 2-1 [Cucumis melo var. makuwa]) HSP 1 Score: 161 bits (407), Expect = 1.63e-43 Identity = 78/85 (91.76%), Postives = 81/85 (95.29%), Query Frame = 0
BLAST of IVF0003738 vs. NCBI nr
Match: XP_011653577.1 (lipoxygenase 2, chloroplastic [Cucumis sativus] >KGN54483.2 hypothetical protein Csa_017997 [Cucumis sativus]) HSP 1 Score: 160 bits (404), Expect = 4.18e-43 Identity = 81/87 (93.10%), Postives = 84/87 (96.55%), Query Frame = 0
BLAST of IVF0003738 vs. NCBI nr
Match: XP_038900328.1 (linoleate 13S-lipoxygenase 2-1, chloroplastic-like [Benincasa hispida]) HSP 1 Score: 148 bits (373), Expect = 6.28e-39 Identity = 71/86 (82.56%), Postives = 79/86 (91.86%), Query Frame = 0
BLAST of IVF0003738 vs. TAIR 10
Match: AT3G45140.1 (lipoxygenase 2 ) HSP 1 Score: 62.0 bits (149), Expect = 3.0e-10 Identity = 39/94 (41.49%), Postives = 50/94 (53.19%), Query Frame = 0
BLAST of IVF0003738 vs. TAIR 10
Match: AT1G55020.1 (lipoxygenase 1 ) HSP 1 Score: 58.5 bits (140), Expect = 3.3e-09 Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 0
BLAST of IVF0003738 vs. TAIR 10
Match: AT1G67560.1 (PLAT/LH2 domain-containing lipoxygenase family protein ) HSP 1 Score: 51.6 bits (122), Expect = 4.1e-07 Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of IVF0003738 vs. TAIR 10
Match: AT1G17420.1 (lipoxygenase 3 ) HSP 1 Score: 51.2 bits (121), Expect = 5.3e-07 Identity = 28/55 (50.91%), Postives = 36/55 (65.45%), Query Frame = 0
BLAST of IVF0003738 vs. TAIR 10
Match: AT1G72520.1 (PLAT/LH2 domain-containing lipoxygenase family protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.9e-05 Identity = 19/52 (36.54%), Postives = 31/52 (59.62%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|