
HG10022465 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGAATTAGACTACCAGATCCCATCTGCATTTGATCCATTTGCCGACGCCAGGGATTCGGATGCCCCCGGAACAAAAGAGTATGTTCATGTCCGTGTCCAGCAGAGGAATGGCAAGAAGTGCTTGACTACAGTTCAAGGTCTGAAGAAAGAGTTCAGCTACGAGAAGATCCTTAAAGACGTGAAGAAGGAATTCTGCTGTAATGGTAACGTTGTGCAAGACAAAGAATTGGGGAAGATAATTCAACTTCAGGGTGATCAGCGCAAGAACGTGTCTCAGTTTCTTGTTCAGGCTGGTCTTGTCAAGAAGGATCAGATCAAGATCCATGGGTTTTGA ATGGTTGAATTAGACTACCAGATCCCATCTGCATTTGATCCATTTGCCGACGCCAGGGATTCGGATGCCCCCGGAACAAAAGAGTATGTTCATGTCCGTGTCCAGCAGAGGAATGGCAAGAAGTGCTTGACTACAGTTCAAGGTCTGAAGAAAGAGTTCAGCTACGAGAAGATCCTTAAAGACGTGAAGAAGGAATTCTGCTGTAATGGTAACGTTGTGCAAGACAAAGAATTGGGGAAGATAATTCAACTTCAGGGTGATCAGCGCAAGAACGTGTCTCAGTTTCTTGTTCAGGCTGGTCTTGTCAAGAAGGATCAGATCAAGATCCATGGGTTTTGA ATGGTTGAATTAGACTACCAGATCCCATCTGCATTTGATCCATTTGCCGACGCCAGGGATTCGGATGCCCCCGGAACAAAAGAGTATGTTCATGTCCGTGTCCAGCAGAGGAATGGCAAGAAGTGCTTGACTACAGTTCAAGGTCTGAAGAAAGAGTTCAGCTACGAGAAGATCCTTAAAGACGTGAAGAAGGAATTCTGCTGTAATGGTAACGTTGTGCAAGACAAAGAATTGGGGAAGATAATTCAACTTCAGGGTGATCAGCGCAAGAACGTGTCTCAGTTTCTTGTTCAGGCTGGTCTTGTCAAGAAGGATCAGATCAAGATCCATGGGTTTTGA MVELDYQIPSAFDPFADARDSDAPGTKEYVHVRVQQRNGKKCLTTVQGLKKEFSYEKILKDVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF Homology
BLAST of HG10022465 vs. NCBI nr
Match: XP_004139787.1 (protein translation factor SUI1 homolog 1 [Cucumis sativus] >XP_008447738.1 PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis melo] >XP_038899382.1 protein translation factor SUI1 homolog 1-like [Benincasa hispida] >KGN44162.1 hypothetical protein Csa_015864 [Cucumis sativus]) HSP 1 Score: 225.7 bits (574), Expect = 2.0e-55 Identity = 109/112 (97.32%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of HG10022465 vs. NCBI nr
Match: KAA0025154.1 (SUI1 domain-containing protein [Cucumis melo var. makuwa] >TYK23112.1 SUI1 domain-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 225.7 bits (574), Expect = 2.0e-55 Identity = 109/112 (97.32%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of HG10022465 vs. NCBI nr
Match: XP_022976609.1 (protein translation factor SUI1 homolog 1 [Cucurbita maxima] >XP_022976610.1 protein translation factor SUI1 homolog 1 [Cucurbita maxima] >KAG6592045.1 Protein translation factor SUI1-like 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 223.4 bits (568), Expect = 9.8e-55 Identity = 108/112 (96.43%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of HG10022465 vs. NCBI nr
Match: XP_023536045.1 (protein translation factor SUI1 homolog 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 222.2 bits (565), Expect = 2.2e-54 Identity = 107/112 (95.54%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of HG10022465 vs. NCBI nr
Match: XP_022936190.1 (protein translation factor SUI1 homolog 1 [Cucurbita moschata]) HSP 1 Score: 222.2 bits (565), Expect = 2.2e-54 Identity = 107/112 (95.54%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy Swiss-Prot
Match: P41568 (Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27130 PE=1 SV=2) HSP 1 Score: 185.7 bits (470), Expect = 3.0e-46 Identity = 91/113 (80.53%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy Swiss-Prot
Match: Q9SQF4 (Protein translation factor SUI1 homolog OS=Brassica oleracea OX=3712 PE=3 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 8.6e-46 Identity = 90/113 (79.65%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy Swiss-Prot
Match: Q94JV4 (Protein translation factor SUI1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At1g54290 PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 1.1e-45 Identity = 89/113 (78.76%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy Swiss-Prot
Match: P56330 (Protein translation factor SUI1 homolog OS=Zea mays OX=4577 GN=TIF PE=3 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 9.5e-45 Identity = 88/115 (76.52%), Postives = 100/115 (86.96%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy Swiss-Prot
Match: A6MZM2 (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. indica OX=39946 GN=GOS2 PE=2 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 9.5e-45 Identity = 88/115 (76.52%), Postives = 100/115 (86.96%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy TrEMBL
Match: A0A5D3DHR8 (SUI1 domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold142G001030 PE=3 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 9.5e-56 Identity = 109/112 (97.32%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy TrEMBL
Match: A0A0A0K771 (SUI1 domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G209580 PE=3 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 9.5e-56 Identity = 109/112 (97.32%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy TrEMBL
Match: A0A1S3BI45 (protein translation factor SUI1 homolog 1-like OS=Cucumis melo OX=3656 GN=LOC103490142 PE=3 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 9.5e-56 Identity = 109/112 (97.32%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy TrEMBL
Match: A0A6J1IJY4 (protein translation factor SUI1 homolog 1 OS=Cucurbita maxima OX=3661 GN=LOC111476953 PE=3 SV=1) HSP 1 Score: 223.4 bits (568), Expect = 4.7e-55 Identity = 108/112 (96.43%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of HG10022465 vs. ExPASy TrEMBL
Match: A0A6J1FCX8 (protein translation factor SUI1 homolog 1 OS=Cucurbita moschata OX=3662 GN=LOC111442862 PE=3 SV=1) HSP 1 Score: 222.2 bits (565), Expect = 1.1e-54 Identity = 107/112 (95.54%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of HG10022465 vs. TAIR 10
Match: AT5G54940.1 (Translation initiation factor SUI1 family protein ) HSP 1 Score: 200.7 bits (509), Expect = 6.3e-52 Identity = 94/112 (83.93%), Postives = 105/112 (93.75%), Query Frame = 0
BLAST of HG10022465 vs. TAIR 10
Match: AT5G54940.2 (Translation initiation factor SUI1 family protein ) HSP 1 Score: 200.7 bits (509), Expect = 6.3e-52 Identity = 94/112 (83.93%), Postives = 105/112 (93.75%), Query Frame = 0
BLAST of HG10022465 vs. TAIR 10
Match: AT4G27130.1 (Translation initiation factor SUI1 family protein ) HSP 1 Score: 185.7 bits (470), Expect = 2.1e-47 Identity = 91/113 (80.53%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of HG10022465 vs. TAIR 10
Match: AT5G54760.1 (Translation initiation factor SUI1 family protein ) HSP 1 Score: 185.3 bits (469), Expect = 2.7e-47 Identity = 91/113 (80.53%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of HG10022465 vs. TAIR 10
Match: AT5G54760.2 (Translation initiation factor SUI1 family protein ) HSP 1 Score: 185.3 bits (469), Expect = 2.7e-47 Identity = 91/113 (80.53%), Postives = 100/113 (88.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|