
HG10022427 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAATGTTAGCTAAGTTTTTGGTGCCATTATTTTCAAGACTACTACTTTTAGTCTTGCTTTTGACGGGTACTAGCGCGACTCTTTTATGTAAGGTCGATACGAATGAGCTTTGTGAGTGTCGACCAGCGATAGCTCCTTTGCACGGACAACGATTGCAACCGCCAACGAAACGCTGTTGTTCAGTGGTCCGTCGTGCCGACCTCAAGTGTTTGTGCAACCTCAAATCAATCCTCCCATCTGCTGGAATTAATACAACCAATGCTTTGGCTTTGCCTCCTAAATGTGGCATTCAAACTCCCCCAGAGTGCCATAGTTATTAG ATGTTAATGTTAGCTAAGTTTTTGGTGCCATTATTTTCAAGACTACTACTTTTAGTCTTGCTTTTGACGGGTACTAGCGCGACTCTTTTATGTAAGGTCGATACGAATGAGCTTTGTGAGTGTCGACCAGCGATAGCTCCTTTGCACGGACAACGATTGCAACCGCCAACGAAACGCTGTTGTTCAGTGGTCCGTCGTGCCGACCTCAAGTGTTTGTGCAACCTCAAATCAATCCTCCCATCTGCTGGAATTAATACAACCAATGCTTTGGCTTTGCCTCCTAAATGTGGCATTCAAACTCCCCCAGAGTGCCATAGTTATTAG ATGTTAATGTTAGCTAAGTTTTTGGTGCCATTATTTTCAAGACTACTACTTTTAGTCTTGCTTTTGACGGGTACTAGCGCGACTCTTTTATGTAAGGTCGATACGAATGAGCTTTGTGAGTGTCGACCAGCGATAGCTCCTTTGCACGGACAACGATTGCAACCGCCAACGAAACGCTGTTGTTCAGTGGTCCGTCGTGCCGACCTCAAGTGTTTGTGCAACCTCAAATCAATCCTCCCATCTGCTGGAATTAATACAACCAATGCTTTGGCTTTGCCTCCTAAATGTGGCATTCAAACTCCCCCAGAGTGCCATAGTTATTAG MLMLAKFLVPLFSRLLLLVLLLTGTSATLLCKVDTNELCECRPAIAPLHGQRLQPPTKRCCSVVRRADLKCLCNLKSILPSAGINTTNALALPPKCGIQTPPECHSY Homology
BLAST of HG10022427 vs. NCBI nr
Match: XP_038896217.1 (putative lipid-transfer protein DIR1 [Benincasa hispida]) HSP 1 Score: 163.7 bits (413), Expect = 8.8e-37 Identity = 81/101 (80.20%), Postives = 85/101 (84.16%), Query Frame = 0
BLAST of HG10022427 vs. NCBI nr
Match: KAA0048160.1 (putative lipid-transfer protein DIR1 [Cucumis melo var. makuwa]) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-33 Identity = 71/87 (81.61%), Postives = 78/87 (89.66%), Query Frame = 0
BLAST of HG10022427 vs. NCBI nr
Match: KAE8646003.1 (hypothetical protein Csa_015464 [Cucumis sativus]) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-33 Identity = 76/99 (76.77%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of HG10022427 vs. NCBI nr
Match: KAG7037350.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 141.0 bits (354), Expect = 6.1e-30 Identity = 69/94 (73.40%), Postives = 75/94 (79.79%), Query Frame = 0
BLAST of HG10022427 vs. NCBI nr
Match: KAG6607773.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 137.9 bits (346), Expect = 5.2e-29 Identity = 68/93 (73.12%), Postives = 74/93 (79.57%), Query Frame = 0
BLAST of HG10022427 vs. ExPASy Swiss-Prot
Match: Q8W453 (Putative lipid-transfer protein DIR1 OS=Arabidopsis thaliana OX=3702 GN=DIR1 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.7e-06 Identity = 33/105 (31.43%), Postives = 58/105 (55.24%), Query Frame = 0
BLAST of HG10022427 vs. ExPASy TrEMBL
Match: A0A5A7TY68 (Putative lipid-transfer protein DIR1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold63G00600 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 9.8e-34 Identity = 71/87 (81.61%), Postives = 78/87 (89.66%), Query Frame = 0
BLAST of HG10022427 vs. ExPASy TrEMBL
Match: A0A0A0LBB0 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G759990 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 9.8e-34 Identity = 76/99 (76.77%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of HG10022427 vs. ExPASy TrEMBL
Match: A0A0A0LAS6 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G760500 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 1.0e-22 Identity = 58/92 (63.04%), Postives = 70/92 (76.09%), Query Frame = 0
BLAST of HG10022427 vs. ExPASy TrEMBL
Match: A0A5A7TX28 (Putative lipid-transfer protein DIR1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold63G00630 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.3e-22 Identity = 61/94 (64.89%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of HG10022427 vs. ExPASy TrEMBL
Match: A0A1S3BHE7 (putative lipid-transfer protein DIR1 OS=Cucumis melo OX=3656 GN=LOC103490109 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.3e-22 Identity = 61/94 (64.89%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of HG10022427 vs. TAIR 10
Match: AT5G55410.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.5 bits (158), Expect = 3.0e-11 Identity = 36/99 (36.36%), Postives = 56/99 (56.57%), Query Frame = 0
BLAST of HG10022427 vs. TAIR 10
Match: AT5G55410.2 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.5 bits (158), Expect = 3.0e-11 Identity = 36/99 (36.36%), Postives = 56/99 (56.57%), Query Frame = 0
BLAST of HG10022427 vs. TAIR 10
Match: AT5G55460.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 5.2e-11 Identity = 37/93 (39.78%), Postives = 52/93 (55.91%), Query Frame = 0
BLAST of HG10022427 vs. TAIR 10
Match: AT5G55450.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 63.9 bits (154), Expect = 8.8e-11 Identity = 31/87 (35.63%), Postives = 50/87 (57.47%), Query Frame = 0
BLAST of HG10022427 vs. TAIR 10
Match: AT5G48485.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-07 Identity = 33/105 (31.43%), Postives = 58/105 (55.24%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|