HG10013795 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCCGCTCAGCCTGCAGGTGATTAATCGATTTGATTATATATTTATAATTTATTTGAGATTAATTCTATGCGATTGAATTTATTTATAATTTTTGTTTTATTAACTTTGGAATTTGTTTTATGGGTTTTTTTTGGGGGGGGGGGGTTATGCGTAGGTGTTTATCCTCCACCCTCCACCGTGCCGACATCTTATGCAGCTCCACCGCCGGCGGGGTATCCGACGAGAGACGGCGGAGACTTCTCTCAACCCGCCCCTGTTCCGGCTGAAACCAAGTCTAGAGGCGATGGCTTTTGGAAAGGCTGGTAA ATGAGTTCCGCTCAGCCTGCAGGTGTTTATCCTCCACCCTCCACCGTGCCGACATCTTATGCAGCTCCACCGCCGGCGGGGTATCCGACGAGAGACGGCGGAGACTTCTCTCAACCCGCCCCTGTTCCGGCTGAAACCAAGTCTAGAGGCGATGGCTTTTGGAAAGGCTGGTAA ATGAGTTCCGCTCAGCCTGCAGGTGTTTATCCTCCACCCTCCACCGTGCCGACATCTTATGCAGCTCCACCGCCGGCGGGGTATCCGACGAGAGACGGCGGAGACTTCTCTCAACCCGCCCCTGTTCCGGCTGAAACCAAGTCTAGAGGCGATGGCTTTTGGAAAGGCTGGTAA MSSAQPAGVYPPPSTVPTSYAAPPPAGYPTRDGGDFSQPAPVPAETKSRGDGFWKGW Homology
BLAST of HG10013795 vs. NCBI nr
Match: KAG6591814.1 (hypothetical protein SDJN03_14160, partial [Cucurbita argyrosperma subsp. sororia] >KAG7024679.1 hypothetical protein SDJN02_13497 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 110.5 bits (275), Expect = 4.7e-21 Identity = 53/56 (94.64%), Postives = 54/56 (96.43%), Query Frame = 0
BLAST of HG10013795 vs. NCBI nr
Match: XP_022137938.1 (cysteine-rich and transmembrane domain-containing protein WIH2-like [Momordica charantia]) HSP 1 Score: 107.8 bits (268), Expect = 3.0e-20 Identity = 52/56 (92.86%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of HG10013795 vs. NCBI nr
Match: KAA0032928.1 (extensin-like [Cucumis melo var. makuwa] >TYK28072.1 extensin-like [Cucumis melo var. makuwa]) HSP 1 Score: 107.1 bits (266), Expect = 5.2e-20 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of HG10013795 vs. NCBI nr
Match: XP_031739667.1 (cysteine-rich and transmembrane domain-containing protein WIH1-like [Cucumis sativus] >KGN54976.1 hypothetical protein Csa_012002 [Cucumis sativus]) HSP 1 Score: 92.8 bits (229), Expect = 1.0e-15 Identity = 51/58 (87.93%), Postives = 53/58 (91.38%), Query Frame = 0
BLAST of HG10013795 vs. NCBI nr
Match: KAF3972548.1 (hypothetical protein CMV_003960 [Castanea mollissima]) HSP 1 Score: 84.3 bits (207), Expect = 3.6e-13 Identity = 40/56 (71.43%), Postives = 44/56 (78.57%), Query Frame = 0
BLAST of HG10013795 vs. ExPASy TrEMBL
Match: A0A6J1CBQ4 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Momordica charantia OX=3673 GN=LOC111009227 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.5e-20 Identity = 52/56 (92.86%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of HG10013795 vs. ExPASy TrEMBL
Match: A0A5D3DX21 (Extensin-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold384G003360 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 2.5e-20 Identity = 55/59 (93.22%), Postives = 56/59 (94.92%), Query Frame = 0
BLAST of HG10013795 vs. ExPASy TrEMBL
Match: A0A0A0L4C6 (CYSTM domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G618410 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 4.9e-16 Identity = 51/58 (87.93%), Postives = 53/58 (91.38%), Query Frame = 0
BLAST of HG10013795 vs. ExPASy TrEMBL
Match: A0A2N9H1G7 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS36239 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 4.6e-14 Identity = 42/57 (73.68%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of HG10013795 vs. ExPASy TrEMBL
Match: A0A7N2LG73 (CYSTM domain-containing protein OS=Quercus lobata OX=97700 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.7e-13 Identity = 40/56 (71.43%), Postives = 44/56 (78.57%), Query Frame = 0
BLAST of HG10013795 vs. TAIR 10
Match: AT2G32190.2 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G32210.1); Has 74 Blast hits to 74 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 74; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 50.1 bits (118), Expect = 7.0e-07 Identity = 28/56 (50.00%), Postives = 30/56 (53.57%), Query Frame = 0
BLAST of HG10013795 vs. TAIR 10
Match: AT2G32190.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G32210.1); Has 218 Blast hits to 218 proteins in 24 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 16; Plants - 202; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 45.8 bits (107), Expect = 1.3e-05 Identity = 27/55 (49.09%), Postives = 29/55 (52.73%), Query Frame = 0
BLAST of HG10013795 vs. TAIR 10
Match: AT3G22240.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G22235.2); Has 177 Blast hits to 177 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 177; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 45.1 bits (105), Expect = 2.3e-05 Identity = 27/50 (54.00%), Postives = 29/50 (58.00%), Query Frame = 0
BLAST of HG10013795 vs. TAIR 10
Match: AT2G32210.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G32190.1); Has 214 Blast hits to 214 proteins in 21 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 10; Plants - 203; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 43.9 bits (102), Expect = 5.0e-05 Identity = 27/55 (49.09%), Postives = 29/55 (52.73%), Query Frame = 0
BLAST of HG10013795 vs. TAIR 10
Match: AT2G32200.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G32210.1); Has 131 Blast hits to 131 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 1; Plants - 130; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 40.8 bits (94), Expect = 4.3e-04 Identity = 28/58 (48.28%), Postives = 30/58 (51.72%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|