HG10012657 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGAAACGGCGAAGTTGAATGCGGCGAGGTCCGGCTTGGTGGTGATCGGAGCTCTGGCCTTCGGATACCTGAGTTTACAGCTCGTGTTCAAGCCCTACCTCGAGAAAACTCAAAGTTCTCTTCAACATCCCGATTCTGAGCCCTCTACAATTCCAAAAGACGGTATTTCAAACCGCGACGATTAA ATGAAGGAAACGGCGAAGTTGAATGCGGCGAGGTCCGGCTTGGTGGTGATCGGAGCTCTGGCCTTCGGATACCTGAGTTTACAGCTCGTGTTCAAGCCCTACCTCGAGAAAACTCAAAGTTCTCTTCAACATCCCGATTCTGAGCCCTCTACAATTCCAAAAGACGGTATTTCAAACCGCGACGATTAA ATGAAGGAAACGGCGAAGTTGAATGCGGCGAGGTCCGGCTTGGTGGTGATCGGAGCTCTGGCCTTCGGATACCTGAGTTTACAGCTCGTGTTCAAGCCCTACCTCGAGAAAACTCAAAGTTCTCTTCAACATCCCGATTCTGAGCCCTCTACAATTCCAAAAGACGGTATTTCAAACCGCGACGATTAA MKETAKLNAARSGLVVIGALAFGYLSLQLVFKPYLEKTQSSLQHPDSEPSTIPKDGISNRDD Homology
BLAST of HG10012657 vs. NCBI nr
Match: KAG7018683.1 (hypothetical protein SDJN02_20554, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 110.9 bits (276), Expect = 3.9e-21 Identity = 56/62 (90.32%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of HG10012657 vs. NCBI nr
Match: KGN57013.1 (hypothetical protein Csa_010432 [Cucumis sativus]) HSP 1 Score: 109.4 bits (272), Expect = 1.1e-20 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of HG10012657 vs. NCBI nr
Match: KAG6582279.1 (hypothetical protein SDJN03_22281, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 107.5 bits (267), Expect = 4.3e-20 Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of HG10012657 vs. NCBI nr
Match: KAA0049387.1 (hypothetical protein E6C27_scaffold171G006320 [Cucumis melo var. makuwa] >TYK17172.1 hypothetical protein E5676_scaffold434G00160 [Cucumis melo var. makuwa]) HSP 1 Score: 99.0 bits (245), Expect = 1.5e-17 Identity = 51/61 (83.61%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of HG10012657 vs. NCBI nr
Match: XP_042939644.1 (outer envelope membrane protein 7 [Carya illinoinensis] >KAG2727424.1 hypothetical protein I3760_01G157400 [Carya illinoinensis] >KAG6668308.1 hypothetical protein CIPAW_01G161200 [Carya illinoinensis] >KAG6732085.1 hypothetical protein I3842_01G159800 [Carya illinoinensis] >KAG7996299.1 hypothetical protein I3843_01G152500 [Carya illinoinensis]) HSP 1 Score: 68.9 bits (167), Expect = 1.7e-08 Identity = 35/52 (67.31%), Postives = 43/52 (82.69%), Query Frame = 0
BLAST of HG10012657 vs. ExPASy TrEMBL
Match: A0A0A0L5N1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G149930 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 5.5e-21 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of HG10012657 vs. ExPASy TrEMBL
Match: A0A5A7U4W2 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G00160 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 7.5e-18 Identity = 51/61 (83.61%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of HG10012657 vs. ExPASy TrEMBL
Match: A0A4D9A3A6 (Uncharacterized protein OS=Salvia splendens OX=180675 GN=Saspl_033849 PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.8e-08 Identity = 36/55 (65.45%), Postives = 40/55 (72.73%), Query Frame = 0
BLAST of HG10012657 vs. ExPASy TrEMBL
Match: W9R337 (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_007349 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 4.1e-08 Identity = 30/51 (58.82%), Postives = 42/51 (82.35%), Query Frame = 0
BLAST of HG10012657 vs. ExPASy TrEMBL
Match: A0A1U7Y866 (uncharacterized protein LOC104242143 OS=Nicotiana sylvestris OX=4096 GN=LOC104242143 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 9.1e-08 Identity = 33/49 (67.35%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of HG10012657 vs. TAIR 10
Match: AT5G19151.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 52.4 bits (124), Expect = 1.5e-07 Identity = 29/55 (52.73%), Postives = 36/55 (65.45%), Query Frame = 0
BLAST of HG10012657 vs. TAIR 10
Match: AT3G63160.1 (FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast outer membrane, thylakoid, chloroplast thylakoid membrane, chloroplast, chloroplast envelope; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: outer envelope membrane protein 7 (TAIR:AT3G52420.1); Has 26 Blast hits to 26 proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 43.1 bits (100), Expect = 9.3e-05 Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of HG10012657 vs. TAIR 10
Match: AT3G52420.1 (outer envelope membrane protein 7 ) HSP 1 Score: 40.8 bits (94), Expect = 4.6e-04 Identity = 19/50 (38.00%), Postives = 34/50 (68.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|