
HG10006208 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTGAGAGAATGAAGGATTGTGGCCTTTCTCCAAGTTTGGTTACTTACAATGTTATGCTTCATGTTTATGGGAAAATAGGTCGCTCTTGGGATAAAATTTTAGGCTTATTCGATGAAACGAGGAGTGAAGGTTTGCAATTTGATGAGTCTACCTGCAATACTATGACATCTGCGTGCGGAAGAAAGGGTTTTATAAATGAAGCTAAATAA ATGTTTGAGAGAATGAAGGATTGTGGCCTTTCTCCAAGTTTGGTTACTTACAATGTTATGCTTCATGTTTATGGGAAAATAGGTCGCTCTTGGGATAAAATTTTAGGCTTATTCGATGAAACGAGGAGTGAAGGTTTGCAATTTGATGAGTCTACCTGCAATACTATGACATCTGCGTGCGGAAGAAAGGGTTTTATAAATGAAGCTAAATAA ATGTTTGAGAGAATGAAGGATTGTGGCCTTTCTCCAAGTTTGGTTACTTACAATGTTATGCTTCATGTTTATGGGAAAATAGGTCGCTCTTGGGATAAAATTTTAGGCTTATTCGATGAAACGAGGAGTGAAGGTTTGCAATTTGATGAGTCTACCTGCAATACTATGACATCTGCGTGCGGAAGAAAGGGTTTTATAAATGAAGCTAAATAA MFERMKDCGLSPSLVTYNVMLHVYGKIGRSWDKILGLFDETRSEGLQFDESTCNTMTSACGRKGFINEAK Homology
BLAST of HG10006208 vs. NCBI nr
Match: KAG7029815.1 (Pentatricopeptide repeat-containing protein, chloroplastic, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 130.2 bits (326), Expect = 7.0e-27 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. NCBI nr
Match: KAG6598873.1 (Pentatricopeptide repeat-containing protein, chloroplastic, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 130.2 bits (326), Expect = 7.0e-27 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. NCBI nr
Match: XP_022997385.1 (pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 129.0 bits (323), Expect = 1.6e-26 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. NCBI nr
Match: XP_022997384.1 (pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 129.0 bits (323), Expect = 1.6e-26 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. NCBI nr
Match: KAG7020910.1 (Pentatricopeptide repeat-containing protein, chloroplastic, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 127.1 bits (318), Expect = 6.0e-26 Identity = 57/70 (81.43%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy Swiss-Prot
Match: O64624 (Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g18940 PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.1e-22 Identity = 46/70 (65.71%), Postives = 59/70 (84.29%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy Swiss-Prot
Match: B8Y6I0 (Pentatricopeptide repeat-containing protein 10, chloroplastic OS=Zea mays OX=4577 GN=PPR10 PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.1e-13 Identity = 32/69 (46.38%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy Swiss-Prot
Match: Q9LYZ9 (Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana OX=3702 GN=At5g02860 PE=2 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.3e-11 Identity = 28/69 (40.58%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy Swiss-Prot
Match: Q9S7Q2 (Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTAC2 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.6e-10 Identity = 30/70 (42.86%), Postives = 47/70 (67.14%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy Swiss-Prot
Match: Q9SIC9 (Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g31400 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 5.8e-08 Identity = 26/70 (37.14%), Postives = 40/70 (57.14%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy TrEMBL
Match: A0A6J1KB83 (pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111492320 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 7.6e-27 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy TrEMBL
Match: A0A6J1K9G3 (pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111492320 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 7.6e-27 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy TrEMBL
Match: A0A6J1FBH7 (pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111443919 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 2.9e-26 Identity = 57/70 (81.43%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy TrEMBL
Match: A0A6J1HWN3 (pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like OS=Cucurbita maxima OX=3661 GN=LOC111468552 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 3.8e-26 Identity = 57/70 (81.43%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of HG10006208 vs. ExPASy TrEMBL
Match: A0A0A0LMF0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G059820 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 4.9e-26 Identity = 58/70 (82.86%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of HG10006208 vs. TAIR 10
Match: AT2G18940.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 104.0 bits (258), Expect = 5.0e-23 Identity = 46/70 (65.71%), Postives = 59/70 (84.29%), Query Frame = 0
BLAST of HG10006208 vs. TAIR 10
Match: AT5G02860.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 67.4 bits (163), Expect = 5.2e-12 Identity = 28/69 (40.58%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of HG10006208 vs. TAIR 10
Match: AT1G74850.1 (plastid transcriptionally active 2 ) HSP 1 Score: 66.2 bits (160), Expect = 1.2e-11 Identity = 30/70 (42.86%), Postives = 47/70 (67.14%), Query Frame = 0
BLAST of HG10006208 vs. TAIR 10
Match: AT2G31400.1 (genomes uncoupled 1 ) HSP 1 Score: 57.8 bits (138), Expect = 4.1e-09 Identity = 26/70 (37.14%), Postives = 40/70 (57.14%), Query Frame = 0
BLAST of HG10006208 vs. TAIR 10
Match: AT2G19280.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 27/69 (39.13%), Postives = 40/69 (57.97%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|