
HG10005706 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTTCGCTTGCCTAGTATCATTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAAGCTTTAGATGTTCCAAAGGGCTACTTTACTGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCACTATCTTGCTTGAACCAACCCTTATTTCAAGATTTATTGAGTCAATCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCACACAAAGCTGA ATGGGTTTTCGCTTGCCTAGTATCATTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAAGCTTTAGATGTTCCAAAGGGCTACTTTACTGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCACTATCTTGCTTGAACCAACCCTTATTTCAAGATTTATTGAGTCAATCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCACACAAAGCTGA ATGGGTTTTCGCTTGCCTAGTATCATTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAAGCTTTAGATGTTCCAAAGGGCTACTTTACTGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCACTATCTTGCTTGAACCAACCCTTATTTCAAGATTTATTGAGTCAATCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCACACAAAGCTGA MGFRLPSIIHAKQSFRRSSSTGNGASPKALDVPKGYFTVYVGEVQKKRFVIPLSCLNQPLFQDLLSQSEEEFGYDHPMGGITIPCSEETFLSLTQS Homology
BLAST of HG10005706 vs. NCBI nr
Match: XP_038887257.1 (auxin-induced protein 15A-like [Benincasa hispida]) HSP 1 Score: 193.4 bits (490), Expect = 9.3e-46 Identity = 91/96 (94.79%), Postives = 94/96 (97.92%), Query Frame = 0
BLAST of HG10005706 vs. NCBI nr
Match: KAG6572081.1 (hypothetical protein SDJN03_28809, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 189.5 bits (480), Expect = 1.3e-44 Identity = 89/96 (92.71%), Postives = 94/96 (97.92%), Query Frame = 0
BLAST of HG10005706 vs. NCBI nr
Match: XP_022135743.1 (auxin-induced protein 15A-like [Momordica charantia]) HSP 1 Score: 183.0 bits (463), Expect = 1.3e-42 Identity = 86/96 (89.58%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of HG10005706 vs. NCBI nr
Match: XP_022135742.1 (indole-3-acetic acid-induced protein ARG7-like [Momordica charantia]) HSP 1 Score: 183.0 bits (463), Expect = 1.3e-42 Identity = 84/95 (88.42%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of HG10005706 vs. NCBI nr
Match: XP_022989148.1 (auxin-induced protein 15A-like [Cucurbita maxima]) HSP 1 Score: 181.4 bits (459), Expect = 3.7e-42 Identity = 85/96 (88.54%), Postives = 92/96 (95.83%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy Swiss-Prot
Match: P32295 (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 6.9e-28 Identity = 63/94 (67.02%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy Swiss-Prot
Match: P33080 (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.2e-26 Identity = 57/94 (60.64%), Postives = 73/94 (77.66%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy Swiss-Prot
Match: P33083 (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.2e-25 Identity = 58/94 (61.70%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy Swiss-Prot
Match: P33079 (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.7e-24 Identity = 55/94 (58.51%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy Swiss-Prot
Match: P33081 (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.7e-24 Identity = 59/94 (62.77%), Postives = 67/94 (71.28%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy TrEMBL
Match: A0A6J1C5R3 (auxin-induced protein 15A-like OS=Momordica charantia OX=3673 GN=LOC111007633 PE=3 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 6.1e-43 Identity = 86/96 (89.58%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy TrEMBL
Match: A0A6J1C3L5 (indole-3-acetic acid-induced protein ARG7-like OS=Momordica charantia OX=3673 GN=LOC111007632 PE=3 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 6.1e-43 Identity = 84/95 (88.42%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy TrEMBL
Match: A0A6J1JPE8 (auxin-induced protein 15A-like OS=Cucurbita maxima OX=3661 GN=LOC111486306 PE=3 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 1.8e-42 Identity = 85/96 (88.54%), Postives = 92/96 (95.83%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy TrEMBL
Match: A0A6J1JPF3 (auxin-induced protein 15A-like OS=Cucurbita maxima OX=3661 GN=LOC111486310 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 5.1e-42 Identity = 81/96 (84.38%), Postives = 92/96 (95.83%), Query Frame = 0
BLAST of HG10005706 vs. ExPASy TrEMBL
Match: A0A6J1C1X1 (auxin-induced protein 15A-like OS=Momordica charantia OX=3673 GN=LOC111007634 PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 2.8e-40 Identity = 82/96 (85.42%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of HG10005706 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.9 bits (294), Expect = 4.6e-27 Identity = 53/94 (56.38%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of HG10005706 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.0 bits (271), Expect = 2.1e-24 Identity = 50/88 (56.82%), Postives = 67/88 (76.14%), Query Frame = 0
BLAST of HG10005706 vs. TAIR 10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.5 bits (267), Expect = 6.2e-24 Identity = 49/88 (55.68%), Postives = 67/88 (76.14%), Query Frame = 0
BLAST of HG10005706 vs. TAIR 10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.9 bits (263), Expect = 1.8e-23 Identity = 49/88 (55.68%), Postives = 67/88 (76.14%), Query Frame = 0
BLAST of HG10005706 vs. TAIR 10
Match: AT5G18010.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.5 bits (262), Expect = 2.4e-23 Identity = 49/88 (55.68%), Postives = 67/88 (76.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|