
HG10004939 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGAACTCCAAAAGTAAAACTTACAAACGAGTTCTTGTTCCATTCTCCGAGGAGCAACTGGCCGGCGTTTTCAAGAATCACGATCGAGACGGCGACGGGAAGCTGACAAAGGAAGAGTTGAAGCAAGCCTTCAAATATCTTGGCTCACGCTACAGCTCCTTTCGAGTCGATGAAGCCCTACGCGCCGCCGATACCGATGGGGATGGTGCCATCAGCATGGCAGAGATGGGCAAGCTAATTAAGTATGCTAAAACTCGTAAATATACTATTAGTTAA ATGGGGAACTCCAAAAGTAAAACTTACAAACGAGTTCTTGTTCCATTCTCCGAGGAGCAACTGGCCGGCGTTTTCAAGAATCACGATCGAGACGGCGACGGGAAGCTGACAAAGGAAGAGTTGAAGCAAGCCTTCAAATATCTTGGCTCACGCTACAGCTCCTTTCGAGTCGATGAAGCCCTACGCGCCGCCGATACCGATGGGGATGGTGCCATCAGCATGGCAGAGATGGGCAAGCTAATTAAGTATGCTAAAACTCGTAAATATACTATTAGTTAA ATGGGGAACTCCAAAAGTAAAACTTACAAACGAGTTCTTGTTCCATTCTCCGAGGAGCAACTGGCCGGCGTTTTCAAGAATCACGATCGAGACGGCGACGGGAAGCTGACAAAGGAAGAGTTGAAGCAAGCCTTCAAATATCTTGGCTCACGCTACAGCTCCTTTCGAGTCGATGAAGCCCTACGCGCCGCCGATACCGATGGGGATGGTGCCATCAGCATGGCAGAGATGGGCAAGCTAATTAAGTATGCTAAAACTCGTAAATATACTATTAGTTAA MGNSKSKTYKRVLVPFSEEQLAGVFKNHDRDGDGKLTKEELKQAFKYLGSRYSSFRVDEALRAADTDGDGAISMAEMGKLIKYAKTRKYTIS Homology
BLAST of HG10004939 vs. NCBI nr
Match: KAA0060899.1 (putative Calcium-binding EF-hand family protein [Cucumis melo var. makuwa]) HSP 1 Score: 168.3 bits (425), Expect = 3.1e-38 Identity = 83/92 (90.22%), Postives = 88/92 (95.65%), Query Frame = 0
BLAST of HG10004939 vs. NCBI nr
Match: KAG6598376.1 (hypothetical protein SDJN03_08154, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 166.0 bits (419), Expect = 1.5e-37 Identity = 82/91 (90.11%), Postives = 87/91 (95.60%), Query Frame = 0
BLAST of HG10004939 vs. NCBI nr
Match: KAG7029343.1 (Calcium-binding protein CML37, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 161.0 bits (406), Expect = 4.9e-36 Identity = 80/91 (87.91%), Postives = 85/91 (93.41%), Query Frame = 0
BLAST of HG10004939 vs. NCBI nr
Match: KAG6585662.1 (hypothetical protein SDJN03_18395, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 159.1 bits (401), Expect = 1.9e-35 Identity = 76/91 (83.52%), Postives = 83/91 (91.21%), Query Frame = 0
BLAST of HG10004939 vs. NCBI nr
Match: KAG7020569.1 (hypothetical protein SDJN02_17255, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 149.8 bits (377), Expect = 1.1e-32 Identity = 73/91 (80.22%), Postives = 81/91 (89.01%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy Swiss-Prot
Match: P62203 (Calmodulin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF14_0323 PE=3 SV=2) HSP 1 Score: 57.4 bits (137), Expect = 1.0e-07 Identity = 27/65 (41.54%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy Swiss-Prot
Match: P24044 (Calmodulin OS=Plasmodium falciparum OX=5833 PE=3 SV=4) HSP 1 Score: 57.4 bits (137), Expect = 1.0e-07 Identity = 27/65 (41.54%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy Swiss-Prot
Match: P05933 (Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cam1 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.7e-07 Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy Swiss-Prot
Match: P27482 (Calmodulin-like protein 3 OS=Homo sapiens OX=9606 GN=CALML3 PE=1 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 5.0e-07 Identity = 25/65 (38.46%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy Swiss-Prot
Match: P84339 (Calmodulin OS=Agaricus bisporus OX=5341 PE=1 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 5.0e-07 Identity = 26/65 (40.00%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy TrEMBL
Match: A0A5A7V5B0 (Putative Calcium-binding EF-hand family protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold501G00320 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.5e-38 Identity = 83/92 (90.22%), Postives = 88/92 (95.65%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy TrEMBL
Match: A0A0A0LRB6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G357340 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 7.4e-38 Identity = 82/92 (89.13%), Postives = 87/92 (94.57%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy TrEMBL
Match: A0A7N2KRS3 (Uncharacterized protein OS=Quercus lobata OX=97700 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 5.9e-19 Identity = 47/87 (54.02%), Postives = 66/87 (75.86%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy TrEMBL
Match: A0A2N9FYQ0 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS20260 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 2.9e-18 Identity = 45/87 (51.72%), Postives = 65/87 (74.71%), Query Frame = 0
BLAST of HG10004939 vs. ExPASy TrEMBL
Match: A0A0A0LP43 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G357350 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 7.9e-16 Identity = 46/83 (55.42%), Postives = 58/83 (69.88%), Query Frame = 0
BLAST of HG10004939 vs. TAIR 10
Match: AT5G12180.1 (calcium-dependent protein kinase 17 ) HSP 1 Score: 53.9 bits (128), Expect = 7.9e-08 Identity = 29/79 (36.71%), Postives = 41/79 (51.90%), Query Frame = 0
BLAST of HG10004939 vs. TAIR 10
Match: AT5G19360.1 (calcium-dependent protein kinase 34 ) HSP 1 Score: 53.9 bits (128), Expect = 7.9e-08 Identity = 29/79 (36.71%), Postives = 41/79 (51.90%), Query Frame = 0
BLAST of HG10004939 vs. TAIR 10
Match: AT4G03290.1 (EF hand calcium-binding protein family ) HSP 1 Score: 52.4 bits (124), Expect = 2.3e-07 Identity = 24/63 (38.10%), Postives = 39/63 (61.90%), Query Frame = 0
BLAST of HG10004939 vs. TAIR 10
Match: AT4G04695.1 (calcium-dependent protein kinase 31 ) HSP 1 Score: 52.4 bits (124), Expect = 2.3e-07 Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 0
BLAST of HG10004939 vs. TAIR 10
Match: AT4G04720.1 (calcium-dependent protein kinase 21 ) HSP 1 Score: 52.0 bits (123), Expect = 3.0e-07 Identity = 31/79 (39.24%), Postives = 39/79 (49.37%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|