Csor.00g221800 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSinitialstart_codonpolypeptideintroninternalterminalstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAGATTCAGTACTCTGAGAAGTACTTCGATGATACTTACGAGTATAGGTCCTGGATTCTTACTCTCAGTTTCTCGTCTTGGAGAATTGTTTGGAAGTGTTTAGTTCTTTGTATTCAATGGCTAACTATATTGATTGATACAGGCATGTGGTGCTCCCACCCGATGTGGCAAAGTTGCTTCCGAAGAATCGCCTTCTCTCGGAAGTAAGCAATTTAGTCTTATTCTTTATTTATGCCTATTAATTTTGTTGCGAAGGGAAGCATTCTCTGACTGTTTTTTTTTTTTAACTTGAATTCGATAGTTGGATTCTTAAATCAGGATTAATAAATGCGTCATCCTTGTTTAGACTGAATTCTCTCTTTCACTCTAAGAAGTTTTTGTTATGTAGTTTTCTAGTCTTTTAAACTTTTCATGGCGATCTTGATTTTCTCTCTTCATTTGGCTGATGATTGTTGAAAATTGAAACGGTGTTTATGTATATTTCGCATAATAGATATATCAAATAGGATTGATAATCCAGGGCTTAAGACTGTTGCGATAGAACCATCCCGGCCTCTCAATCGTGCATTCTCTGTGTGCAACCAGTGAGCAATGGACTTTACAATTAGCATAGGCACAGGAATATCGTTCATTATACCGTCAGTTCCTTTTGATTTTCTTGAATTTCTTAAAGAACATAAGTTAATCATTGTTCTAAACAAAAGGGTGCTTCCCAAATCTGTTCGAGTACTCATTTACTGGAAAGCATGTTGTTGTACTCCTAATCCTATAAATAATCAATCCTATGTGCAGAATGAGTGGCGTGCAATTGGAGTTCAGCAGAGTCGTGGGTGGGTGCACTATGCTATTCATCGACCTGAGCCGCATATCATGCTATTCCGGAGGCCCCTGAACTACCAACAGCAGCAGGAGAACCTCGCTCAACAGAACGTGCTTGCTGCTAAATGA ATGGGTCAGATTCAGTACTCTGAGAAGTACTTCGATGATACTTACGAGTATAGGCATGTGGTGCTCCCACCCGATGTGGCAAAGTTGCTTCCGAAGAATCGCCTTCTCTCGGAAAATGAGTGGCGTGCAATTGGAGTTCAGCAGAGTCGTGGGTGGGTGCACTATGCTATTCATCGACCTGAGCCGCATATCATGCTATTCCGGAGGCCCCTGAACTACCAACAGCAGCAGGAGAACCTCGCTCAACAGAACGTGCTTGCTGCTAAATGA ATGGGTCAGATTCAGTACTCTGAGAAGTACTTCGATGATACTTACGAGTATAGGCATGTGGTGCTCCCACCCGATGTGGCAAAGTTGCTTCCGAAGAATCGCCTTCTCTCGGAAAATGAGTGGCGTGCAATTGGAGTTCAGCAGAGTCGTGGGTGGGTGCACTATGCTATTCATCGACCTGAGCCGCATATCATGCTATTCCGGAGGCCCCTGAACTACCAACAGCAGCAGGAGAACCTCGCTCAACAGAACGTGCTTGCTGCTAAATGA MGQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENLAQQNVLAAK Homology
BLAST of Csor.00g221800 vs. ExPASy Swiss-Prot
Match: O23249 (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CKS1 PE=1 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 7.8e-42 Identity = 78/82 (95.12%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy Swiss-Prot
Match: A2XCH8 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica OX=39946 GN=CKS1 PE=2 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 1.1e-40 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy Swiss-Prot
Match: Q6PS57 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CKS1 PE=2 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 1.1e-40 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy Swiss-Prot
Match: Q9SJJ5 (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CKS2 PE=1 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 4.0e-38 Identity = 70/78 (89.74%), Postives = 77/78 (98.72%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy Swiss-Prot
Match: P55933 (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum OX=5791 PE=1 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 4.5e-29 Identity = 54/66 (81.82%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of Csor.00g221800 vs. NCBI nr
Match: XP_022957804.1 (cyclin-dependent kinases regulatory subunit 1 [Cucurbita moschata] >XP_022996399.1 cyclin-dependent kinases regulatory subunit 1 [Cucurbita maxima] >XP_023534106.1 cyclin-dependent kinases regulatory subunit 1 isoform X3 [Cucurbita pepo subsp. pepo] >KAG6606027.1 Cyclin-dependent kinases regulatory subunit 2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7035974.1 Cyclin-dependent kinases regulatory subunit 2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 187 bits (475), Expect = 7.00e-60 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of Csor.00g221800 vs. NCBI nr
Match: XP_038902899.1 (cyclin-dependent kinases regulatory subunit 1-like [Benincasa hispida]) HSP 1 Score: 183 bits (465), Expect = 2.35e-58 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Csor.00g221800 vs. NCBI nr
Match: XP_022944260.1 (cyclin-dependent kinases regulatory subunit 1-like [Cucurbita moschata] >XP_023513375.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 182 bits (462), Expect = 6.75e-58 Identity = 86/89 (96.63%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Csor.00g221800 vs. NCBI nr
Match: XP_022986411.1 (cyclin-dependent kinases regulatory subunit 1-like [Cucurbita maxima]) HSP 1 Score: 181 bits (459), Expect = 1.94e-57 Identity = 85/89 (95.51%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Csor.00g221800 vs. NCBI nr
Match: XP_028756892.1 (cyclin-dependent kinases regulatory subunit 1 [Prosopis alba] >XP_028788395.1 cyclin-dependent kinases regulatory subunit 1 [Prosopis alba]) HSP 1 Score: 181 bits (459), Expect = 1.94e-57 Identity = 85/89 (95.51%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy TrEMBL
Match: A0A6J1K8L9 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita maxima OX=3661 GN=LOC111491633 PE=3 SV=1) HSP 1 Score: 187 bits (475), Expect = 3.39e-60 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy TrEMBL
Match: A0A6J1H322 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita moschata OX=3662 GN=LOC111459235 PE=3 SV=1) HSP 1 Score: 187 bits (475), Expect = 3.39e-60 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy TrEMBL
Match: A0A6J1FYK0 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita moschata OX=3662 GN=LOC111448764 PE=3 SV=1) HSP 1 Score: 182 bits (462), Expect = 3.27e-58 Identity = 86/89 (96.63%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy TrEMBL
Match: A0A6J1JB14 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita maxima OX=3661 GN=LOC111484154 PE=3 SV=1) HSP 1 Score: 181 bits (459), Expect = 9.38e-58 Identity = 85/89 (95.51%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Csor.00g221800 vs. ExPASy TrEMBL
Match: A0A6A3D0T7 (Cyclin-dependent kinases regulatory subunit OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00001644pilonHSYRG00603 PE=3 SV=1) HSP 1 Score: 179 bits (455), Expect = 3.71e-57 Identity = 83/87 (95.40%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Csor.00g221800 vs. TAIR 10
Match: AT2G27960.1 (cyclin-dependent kinase-subunit 1 ) HSP 1 Score: 170.6 bits (431), Expect = 5.6e-43 Identity = 78/82 (95.12%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Csor.00g221800 vs. TAIR 10
Match: AT2G27970.1 (CDK-subunit 2 ) HSP 1 Score: 158.3 bits (399), Expect = 2.9e-39 Identity = 70/78 (89.74%), Postives = 77/78 (98.72%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|