Csor.00g036300 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglepolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCTATAGAAGCAGCTTCCATACAAAACAATGCGAGGCTCCAAGACTCGGATGATATCCATTATGGTGGTTGGGTGGCGATTATGGATATCAATGACCCATACGTGCAAGAGCTTGGAAGGTTTGCGGTGATGGAGCATGCCATGCAAAGCAAGGAAGATGTGACTTTCACGAAGGTGGTAAGCGGTGCGACTCAAGTTGTGGCTGGAAAAGCCTATCGGCTGGTGATAAAGGGAGTAAGTAATAGCGAGAAAATGTTTTCGTATTTCGAGGCTGTGGTGTTGGATATACCATGGGAGCACTCATGGAAACTCCTGTCTTTTAAGCCTCGCCCTATAGTTTAA ATGAGTTCTATAGAAGCAGCTTCCATACAAAACAATGCGAGGCTCCAAGACTCGGATGATATCCATTATGGTGGTTGGGTGGCGATTATGGATATCAATGACCCATACGTGCAAGAGCTTGGAAGGTTTGCGGTGATGGAGCATGCCATGCAAAGCAAGGAAGATGTGACTTTCACGAAGGTGGTAAGCGGTGCGACTCAAGTTGTGGCTGGAAAAGCCTATCGGCTGGTGATAAAGGGAGTAAGTAATAGCGAGAAAATGTTTTCGTATTTCGAGGCTGTGGTGTTGGATATACCATGGGAGCACTCATGGAAACTCCTGTCTTTTAAGCCTCGCCCTATAGTTTAA ATGAGTTCTATAGAAGCAGCTTCCATACAAAACAATGCGAGGCTCCAAGACTCGGATGATATCCATTATGGTGGTTGGGTGGCGATTATGGATATCAATGACCCATACGTGCAAGAGCTTGGAAGGTTTGCGGTGATGGAGCATGCCATGCAAAGCAAGGAAGATGTGACTTTCACGAAGGTGGTAAGCGGTGCGACTCAAGTTGTGGCTGGAAAAGCCTATCGGCTGGTGATAAAGGGAGTAAGTAATAGCGAGAAAATGTTTTCGTATTTCGAGGCTGTGGTGTTGGATATACCATGGGAGCACTCATGGAAACTCCTGTCTTTTAAGCCTCGCCCTATAGTTTAA MSSIEAASIQNNARLQDSDDIHYGGWVAIMDINDPYVQELGRFAVMEHAMQSKEDVTFTKVVSGATQVVAGKAYRLVIKGVSNSEKMFSYFEAVVLDIPWEHSWKLLSFKPRPIV Homology
BLAST of Csor.00g036300 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 39/88 (44.32%), Postives = 53/88 (60.23%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 38/87 (43.68%), Postives = 52/87 (59.77%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 38/87 (43.68%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 5.4e-11 Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 5.4e-11 Identity = 36/86 (41.86%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Csor.00g036300 vs. NCBI nr
Match: KAG6592143.1 (Cysteine proteinase inhibitor 8, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 231 bits (588), Expect = 2.70e-76 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 0
BLAST of Csor.00g036300 vs. NCBI nr
Match: XP_022936219.1 (cysteine proteinase inhibitor 8-like [Cucurbita moschata]) HSP 1 Score: 229 bits (583), Expect = 1.56e-75 Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 0
BLAST of Csor.00g036300 vs. NCBI nr
Match: XP_023536173.1 (cysteine proteinase inhibitor 8-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 223 bits (569), Expect = 2.14e-73 Identity = 110/115 (95.65%), Postives = 113/115 (98.26%), Query Frame = 0
BLAST of Csor.00g036300 vs. NCBI nr
Match: XP_022975718.1 (cysteine proteinase inhibitor 6-like [Cucurbita maxima]) HSP 1 Score: 216 bits (550), Expect = 1.69e-70 Identity = 107/115 (93.04%), Postives = 109/115 (94.78%), Query Frame = 0
BLAST of Csor.00g036300 vs. NCBI nr
Match: KAG6592147.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 112 bits (281), Expect = 1.60e-29 Identity = 59/111 (53.15%), Postives = 74/111 (66.67%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy TrEMBL
Match: A0A6J1F7P6 (cysteine proteinase inhibitor 8-like OS=Cucurbita moschata OX=3662 GN=LOC111442891 PE=4 SV=1) HSP 1 Score: 229 bits (583), Expect = 7.57e-76 Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy TrEMBL
Match: A0A6J1IK33 (cysteine proteinase inhibitor 6-like OS=Cucurbita maxima OX=3661 GN=LOC111475798 PE=4 SV=1) HSP 1 Score: 216 bits (550), Expect = 8.19e-71 Identity = 107/115 (93.04%), Postives = 109/115 (94.78%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy TrEMBL
Match: A0A6J1F7P2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442887 PE=4 SV=1) HSP 1 Score: 111 bits (278), Expect = 2.21e-29 Identity = 59/111 (53.15%), Postives = 74/111 (66.67%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy TrEMBL
Match: A0A6J1IHI0 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475768 PE=4 SV=1) HSP 1 Score: 111 bits (277), Expect = 3.14e-29 Identity = 56/111 (50.45%), Postives = 76/111 (68.47%), Query Frame = 0
BLAST of Csor.00g036300 vs. ExPASy TrEMBL
Match: A0A6J1F6X0 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442889 PE=4 SV=1) HSP 1 Score: 110 bits (276), Expect = 4.45e-29 Identity = 58/111 (52.25%), Postives = 74/111 (66.67%), Query Frame = 0
BLAST of Csor.00g036300 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 68.6 bits (166), Expect = 3.9e-12 Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 0
BLAST of Csor.00g036300 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 64.3 bits (155), Expect = 7.3e-11 Identity = 36/82 (43.90%), Postives = 50/82 (60.98%), Query Frame = 0
BLAST of Csor.00g036300 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 44.3 bits (103), Expect = 7.8e-05 Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 0
BLAST of Csor.00g036300 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 44.3 bits (103), Expect = 7.8e-05 Identity = 25/74 (33.78%), Postives = 38/74 (51.35%), Query Frame = 0
BLAST of Csor.00g036300 vs. TAIR 10
Match: AT2G31980.1 (PHYTOCYSTATIN 2 ) HSP 1 Score: 43.1 bits (100), Expect = 1.7e-04 Identity = 30/92 (32.61%), Postives = 46/92 (50.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|