Csor.00g036280 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglepolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCTGTAGCAGCTAAGTCCCAAAACGATGCCCTCGTCGCAAACCGAGAAAATATAATACCCGGTGGGTGGACTCACATTAAGGATATCAATGACCCACAAGTGCAAGAGAGGGGAAGGTTTGCAGTGATGGAGCACAACAACCAAAGTGGGGAACACTTGATTTTCTCACATGTTGATGATGGTTGGACTCAAGTTGTATCAGGAATTAACTACCGCCTTGTGATAAGGGCAACAAAAGAGGGCGATAATGGGCTTTATTTCTATGAGGCTATCGTGTGGGATGTTCCATGGGAGCACTCATGGACCCTCACATCCTTTATGCCTCTCCTTAAATACTAA ATGAGTTCTGTAGCAGCTAAGTCCCAAAACGATGCCCTCGTCGCAAACCGAGAAAATATAATACCCGGTGGGTGGACTCACATTAAGGATATCAATGACCCACAAGTGCAAGAGAGGGGAAGGTTTGCAGTGATGGAGCACAACAACCAAAGTGGGGAACACTTGATTTTCTCACATGTTGATGATGGTTGGACTCAAGTTGTATCAGGAATTAACTACCGCCTTGTGATAAGGGCAACAAAAGAGGGCGATAATGGGCTTTATTTCTATGAGGCTATCGTGTGGGATGTTCCATGGGAGCACTCATGGACCCTCACATCCTTTATGCCTCTCCTTAAATACTAA ATGAGTTCTGTAGCAGCTAAGTCCCAAAACGATGCCCTCGTCGCAAACCGAGAAAATATAATACCCGGTGGGTGGACTCACATTAAGGATATCAATGACCCACAAGTGCAAGAGAGGGGAAGGTTTGCAGTGATGGAGCACAACAACCAAAGTGGGGAACACTTGATTTTCTCACATGTTGATGATGGTTGGACTCAAGTTGTATCAGGAATTAACTACCGCCTTGTGATAAGGGCAACAAAAGAGGGCGATAATGGGCTTTATTTCTATGAGGCTATCGTGTGGGATGTTCCATGGGAGCACTCATGGACCCTCACATCCTTTATGCCTCTCCTTAAATACTAA MSSVAAKSQNDALVANRENIIPGGWTHIKDINDPQVQERGRFAVMEHNNQSGEHLIFSHVDDGWTQVVSGINYRLVIRATKEGDNGLYFYEAIVWDVPWEHSWTLTSFMPLLKY Homology
BLAST of Csor.00g036280 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 92.4 bits (228), Expect = 3.5e-18 Identity = 47/97 (48.45%), Postives = 64/97 (65.98%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.0e-17 Identity = 47/97 (48.45%), Postives = 63/97 (64.95%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 85.5 bits (210), Expect = 4.2e-16 Identity = 46/88 (52.27%), Postives = 53/88 (60.23%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.6e-13 Identity = 39/89 (43.82%), Postives = 55/89 (61.80%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 7.5e-13 Identity = 38/88 (43.18%), Postives = 53/88 (60.23%), Query Frame = 0
BLAST of Csor.00g036280 vs. NCBI nr
Match: KAG6592145.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 245 bits (625), Expect = 5.67e-82 Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 0
BLAST of Csor.00g036280 vs. NCBI nr
Match: XP_022936214.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 228 bits (580), Expect = 4.30e-75 Identity = 106/114 (92.98%), Postives = 109/114 (95.61%), Query Frame = 0
BLAST of Csor.00g036280 vs. NCBI nr
Match: KAG6592147.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 227 bits (579), Expect = 6.11e-75 Identity = 106/114 (92.98%), Postives = 109/114 (95.61%), Query Frame = 0
BLAST of Csor.00g036280 vs. NCBI nr
Match: XP_023536175.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo] >XP_023536177.1 cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo] >XP_023536179.1 cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 224 bits (571), Expect = 9.83e-74 Identity = 103/114 (90.35%), Postives = 108/114 (94.74%), Query Frame = 0
BLAST of Csor.00g036280 vs. NCBI nr
Match: XP_022936216.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 220 bits (560), Expect = 4.84e-72 Identity = 101/114 (88.60%), Postives = 107/114 (93.86%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy TrEMBL
Match: A0A6J1F7P2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442887 PE=4 SV=1) HSP 1 Score: 228 bits (580), Expect = 2.08e-75 Identity = 106/114 (92.98%), Postives = 109/114 (95.61%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy TrEMBL
Match: A0A6J1F6X0 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442889 PE=4 SV=1) HSP 1 Score: 220 bits (560), Expect = 2.34e-72 Identity = 101/114 (88.60%), Postives = 107/114 (93.86%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy TrEMBL
Match: A0A6J1IHI0 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475768 PE=4 SV=1) HSP 1 Score: 216 bits (551), Expect = 5.53e-71 Identity = 100/114 (87.72%), Postives = 106/114 (92.98%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy TrEMBL
Match: A0A6J1DHK4 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111021157 PE=4 SV=1) HSP 1 Score: 125 bits (314), Expect = 7.62e-35 Identity = 65/115 (56.52%), Postives = 82/115 (71.30%), Query Frame = 0
BLAST of Csor.00g036280 vs. ExPASy TrEMBL
Match: A0A6J1IK33 (cysteine proteinase inhibitor 6-like OS=Cucurbita maxima OX=3661 GN=LOC111475798 PE=4 SV=1) HSP 1 Score: 122 bits (307), Expect = 8.33e-34 Identity = 62/111 (55.86%), Postives = 76/111 (68.47%), Query Frame = 0
BLAST of Csor.00g036280 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 85.5 bits (210), Expect = 3.0e-17 Identity = 46/88 (52.27%), Postives = 53/88 (60.23%), Query Frame = 0
BLAST of Csor.00g036280 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 70.1 bits (170), Expect = 1.3e-12 Identity = 38/84 (45.24%), Postives = 52/84 (61.90%), Query Frame = 0
BLAST of Csor.00g036280 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 45.1 bits (105), Expect = 4.5e-05 Identity = 28/77 (36.36%), Postives = 37/77 (48.05%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|