CsaV3_7G000590 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTCCGCTTGCCTAGTATTGTTCATGCTAAGCAAAGTTTTCAGCGTTCTTCAACAATGAGAAATGGAGCATCTCCAACGGTTGTAGATGTTCCAAAGGGCTACTTTACAGTTTATGTTGGTGAGACACAGAAGAGGCGTTTCGTCATCCCGCTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTAAGTCAAGCAGAAGAAGAGTTTGGATATGATCATTCAATGGGTGGCATCACAATTCCTTGCAGTGAAGCAATTTTTCTCAGTCTCACACAAAGCTGA ATGGGTTTCCGCTTGCCTAGTATTGTTCATGCTAAGCAAAGTTTTCAGCGTTCTTCAACAATGAGAAATGGAGCATCTCCAACGGTTGTAGATGTTCCAAAGGGCTACTTTACAGTTTATGTTGGTGAGACACAGAAGAGGCGTTTCGTCATCCCGCTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTAAGTCAAGCAGAAGAAGAGTTTGGATATGATCATTCAATGGGTGGCATCACAATTCCTTGCAGTGAAGCAATTTTTCTCAGTCTCACACAAAGCTGA ATGGGTTTCCGCTTGCCTAGTATTGTTCATGCTAAGCAAAGTTTTCAGCGTTCTTCAACAATGAGAAATGGAGCATCTCCAACGGTTGTAGATGTTCCAAAGGGCTACTTTACAGTTTATGTTGGTGAGACACAGAAGAGGCGTTTCGTCATCCCGCTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTAAGTCAAGCAGAAGAAGAGTTTGGATATGATCATTCAATGGGTGGCATCACAATTCCTTGCAGTGAAGCAATTTTTCTCAGTCTCACACAAAGCTGA MGFRLPSIVHAKQSFQRSSTMRNGASPTVVDVPKGYFTVYVGETQKRRFVIPLSCLNQPSFQDLLSQAEEEFGYDHSMGGITIPCSEAIFLSLTQS* Homology
BLAST of CsaV3_7G000590 vs. NCBI nr
Match: KGN43199.1 (hypothetical protein Csa_020562 [Cucumis sativus]) HSP 1 Score: 199.9 bits (507), Expect = 1.0e-47 Identity = 96/96 (100.00%), Postives = 96/96 (100.00%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. NCBI nr
Match: XP_038887257.1 (auxin-induced protein 15A-like [Benincasa hispida]) HSP 1 Score: 180.6 bits (457), Expect = 6.3e-42 Identity = 85/96 (88.54%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. NCBI nr
Match: KAG6572081.1 (hypothetical protein SDJN03_28809, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 175.6 bits (444), Expect = 2.0e-40 Identity = 83/96 (86.46%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. NCBI nr
Match: XP_022989148.1 (auxin-induced protein 15A-like [Cucurbita maxima]) HSP 1 Score: 169.5 bits (428), Expect = 1.5e-38 Identity = 81/96 (84.38%), Postives = 85/96 (88.54%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. NCBI nr
Match: XP_022989153.1 (auxin-induced protein 15A-like [Cucurbita maxima]) HSP 1 Score: 169.5 bits (428), Expect = 1.5e-38 Identity = 78/96 (81.25%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy Swiss-Prot
Match: P32295 (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.9e-26 Identity = 60/94 (63.83%), Postives = 69/94 (73.40%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy Swiss-Prot
Match: P33080 (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.3e-25 Identity = 58/94 (61.70%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy Swiss-Prot
Match: P33083 (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 4.7e-24 Identity = 58/94 (61.70%), Postives = 67/94 (71.28%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy Swiss-Prot
Match: P33082 (Auxin-induced protein X15 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.4e-23 Identity = 56/94 (59.57%), Postives = 63/94 (67.02%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy Swiss-Prot
Match: P33079 (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.8e-23 Identity = 56/94 (59.57%), Postives = 68/94 (72.34%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy TrEMBL
Match: A0A0A0K2F0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008460 PE=3 SV=1) HSP 1 Score: 199.9 bits (507), Expect = 4.9e-48 Identity = 96/96 (100.00%), Postives = 96/96 (100.00%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy TrEMBL
Match: A0A6J1JPF3 (auxin-induced protein 15A-like OS=Cucurbita maxima OX=3661 GN=LOC111486310 PE=3 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 7.0e-39 Identity = 78/96 (81.25%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy TrEMBL
Match: A0A6J1JPE8 (auxin-induced protein 15A-like OS=Cucurbita maxima OX=3661 GN=LOC111486306 PE=3 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 7.0e-39 Identity = 81/96 (84.38%), Postives = 85/96 (88.54%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy TrEMBL
Match: A0A6J1C5R3 (auxin-induced protein 15A-like OS=Momordica charantia OX=3673 GN=LOC111007633 PE=3 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 2.7e-38 Identity = 80/96 (83.33%), Postives = 84/96 (87.50%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. ExPASy TrEMBL
Match: A0A6J1C3L5 (indole-3-acetic acid-induced protein ARG7-like OS=Momordica charantia OX=3673 GN=LOC111007632 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.7e-37 Identity = 77/95 (81.05%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.2 bits (287), Expect = 3.0e-26 Identity = 51/94 (54.26%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. TAIR 10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 103.6 bits (257), Expect = 9.1e-23 Identity = 47/88 (53.41%), Postives = 66/88 (75.00%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. TAIR 10
Match: AT4G34770.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.5 bits (249), Expect = 7.7e-22 Identity = 52/97 (53.61%), Postives = 66/97 (68.04%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. TAIR 10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.5 bits (249), Expect = 7.7e-22 Identity = 46/88 (52.27%), Postives = 65/88 (73.86%), Query Frame = 0
BLAST of CsaV3_7G000590 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.1 bits (248), Expect = 1.0e-21 Identity = 46/88 (52.27%), Postives = 65/88 (73.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|