
CsaV3_6G049710 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTACAGTTGGAAGAGTCCTCTCCGGTGAGGGTATAACGGAGTATCCAGGAAAACTCACTCCCTTCGTCACCATAACATGCATCGTTGCTGCCATGGGTGGCCTCATTTTCGGTTATGATATTGGGATTTCAGGTATTAATTTCTTAAATGTTCCTAATCTTTATCTTCTGTTTAAAAAATATCACCATTCAAAAGTACGTGAGAAAGTTCGAACTGCTACTGCTACTACGATATTTCAAGTCTTAGAAGTATATTTCTTAAATGAATTGAAAAGTTGA ATGGCTACAGTTGGAAGAGTCCTCTCCGGTGAGGGTATAACGGAGTATCCAGGAAAACTCACTCCCTTCGTCACCATAACATGCATCGTTGCTGCCATGGGTGGCCTCATTTTCGGTATTAATTTCTTAAATGTTCCTAATCTTTATCTTCTGTTTAAAAAATATCACCATTCAAAAGTACGTGAGAAAGTTCGAACTGCTACTGCTACTACGATATTTCAAGTCTTAGAAGTATATTTCTTAAATGAATTGAAAAGTTGA ATGGCTACAGTTGGAAGAGTCCTCTCCGGTGAGGGTATAACGGAGTATCCAGGAAAACTCACTCCCTTCGTCACCATAACATGCATCGTTGCTGCCATGGGTGGCCTCATTTTCGGTATTAATTTCTTAAATGTTCCTAATCTTTATCTTCTGTTTAAAAAATATCACCATTCAAAAGTACGTGAGAAAGTTCGAACTGCTACTGCTACTACGATATTTCAAGTCTTAGAAGTATATTTCTTAAATGAATTGAAAAGTTGA MATVGRVLSGEGITEYPGKLTPFVTITCIVAAMGGLIFGINFLNVPNLYLLFKKYHHSKVREKVRTATATTIFQVLEVYFLNELKS* Homology
BLAST of CsaV3_6G049710 vs. NCBI nr
Match: KAE8647681.1 (hypothetical protein Csa_004381 [Cucumis sativus]) HSP 1 Score: 173.7 bits (439), Expect = 6.9e-40 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. NCBI nr
Match: XP_031743134.1 (sugar transport protein 1 isoform X2 [Cucumis sativus]) HSP 1 Score: 81.6 bits (200), Expect = 3.6e-12 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. NCBI nr
Match: TYK13101.1 (sugar carrier protein C-like [Cucumis melo var. makuwa]) HSP 1 Score: 81.6 bits (200), Expect = 3.6e-12 Identity = 43/71 (60.56%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. NCBI nr
Match: XP_004134962.1 (sugar carrier protein C isoform X1 [Cucumis sativus] >AJP77611.1 hexose transporter 2 [Cucumis sativus]) HSP 1 Score: 81.6 bits (200), Expect = 3.6e-12 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. NCBI nr
Match: XP_008439909.1 (PREDICTED: sugar carrier protein C-like [Cucumis melo] >KAA0052724.1 sugar carrier protein C-like [Cucumis melo var. makuwa]) HSP 1 Score: 81.6 bits (200), Expect = 3.6e-12 Identity = 43/71 (60.56%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy Swiss-Prot
Match: O65413 (Sugar transport protein 12 OS=Arabidopsis thaliana OX=3702 GN=STP12 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.1e-07 Identity = 28/39 (71.79%), Postives = 33/39 (84.62%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy Swiss-Prot
Match: P23586 (Sugar transport protein 1 OS=Arabidopsis thaliana OX=3702 GN=STP1 PE=1 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 1.0e-06 Identity = 30/73 (41.10%), Postives = 41/73 (56.16%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy Swiss-Prot
Match: Q41144 (Sugar carrier protein C OS=Ricinus communis OX=3988 GN=STC PE=2 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 4.4e-05 Identity = 27/58 (46.55%), Postives = 35/58 (60.34%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy Swiss-Prot
Match: Q6Z401 (Sugar transport protein MST6 OS=Oryza sativa subsp. japonica OX=39947 GN=MST6 PE=1 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 2.2e-04 Identity = 22/35 (62.86%), Postives = 25/35 (71.43%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy Swiss-Prot
Match: Q7EZD7 (Sugar transport protein MST3 OS=Oryza sativa subsp. japonica OX=39947 GN=MST3 PE=2 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 2.8e-04 Identity = 22/35 (62.86%), Postives = 25/35 (71.43%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy TrEMBL
Match: A0A0A0KHI8 (Hexose transporter 2 OS=Cucumis sativus OX=3659 GN=HT2 PE=2 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.7e-12 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy TrEMBL
Match: A0A5D3CMR6 (Sugar carrier protein C-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G007100 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.7e-12 Identity = 43/71 (60.56%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy TrEMBL
Match: A0A5A7UBG5 (Sugar carrier protein C-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold120G003370 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.7e-12 Identity = 43/71 (60.56%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy TrEMBL
Match: A0A1S3AZG7 (sugar carrier protein C-like OS=Cucumis melo OX=3656 GN=LOC103484555 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.7e-12 Identity = 43/71 (60.56%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. ExPASy TrEMBL
Match: A0A2C9U4M3 (MFS domain-containing protein OS=Manihot esculenta OX=3983 GN=MANES_17G033300 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 2.2e-07 Identity = 36/77 (46.75%), Postives = 44/77 (57.14%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. TAIR 10
Match: AT4G21480.1 (sugar transporter protein 12 ) HSP 1 Score: 56.2 bits (134), Expect = 1.5e-08 Identity = 28/39 (71.79%), Postives = 33/39 (84.62%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. TAIR 10
Match: AT1G11260.1 (sugar transporter 1 ) HSP 1 Score: 53.9 bits (128), Expect = 7.4e-08 Identity = 30/73 (41.10%), Postives = 41/73 (56.16%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. TAIR 10
Match: AT5G23270.1 (sugar transporter 11 ) HSP 1 Score: 43.9 bits (102), Expect = 7.7e-05 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. TAIR 10
Match: AT1G50310.1 (sugar transporter 9 ) HSP 1 Score: 41.2 bits (95), Expect = 5.0e-04 Identity = 19/30 (63.33%), Postives = 22/30 (73.33%), Query Frame = 0
BLAST of CsaV3_6G049710 vs. TAIR 10
Match: AT3G19940.1 (Major facilitator superfamily protein ) HSP 1 Score: 41.2 bits (95), Expect = 5.0e-04 Identity = 19/30 (63.33%), Postives = 22/30 (73.33%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|