
CsaV3_3G039630 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACGTTATATCTTGAAATTAATTTGTCAAGTTGATGCTAAAATACACAAAGGTTTTGGTGGACATTATGCACTTGTTACACAACCACCTTTTAGAGGCAGGGCCAACAAGGTATCAACAGGCGCCTGTAAACTAGGCACTCTCCAAATGGTACTGGATTGA ATGGAACGTTATATCTTGAAATTAATTTGTCAAGTTGATGCTAAAATACACAAAGGTTTTGGTGGACATTATGCACTTGTTACACAACCACCTTTTAGAGGCAGGGCCAACAAGGTATCAACAGGCGCCTGTAAACTAGGCACTCTCCAAATGGTACTGGATTGA ATGGAACGTTATATCTTGAAATTAATTTGTCAAGTTGATGCTAAAATACACAAAGGTTTTGGTGGACATTATGCACTTGTTACACAACCACCTTTTAGAGGCAGGGCCAACAAGGTATCAACAGGCGCCTGTAAACTAGGCACTCTCCAAATGGTACTGGATTGA MERYILKLICQVDAKIHKGFGGHYALVTQPPFRGRANKVSTGACKLGTLQMVLD* Homology
BLAST of CsaV3_3G039630 vs. NCBI nr
Match: KGN59384.1 (hypothetical protein Csa_002515 [Cucumis sativus]) HSP 1 Score: 117.5 bits (293), Expect = 3.7e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. NCBI nr
Match: RZC81245.1 (hypothetical protein C5167_043860 [Papaver somniferum]) HSP 1 Score: 57.8 bits (138), Expect = 3.5e-05 Identity = 29/48 (60.42%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. NCBI nr
Match: YP_009435125.1 (RNA polymerase beta subunit [Lobelia linearis] >ATG25127.1 RNA polymerase beta subunit [Lobelia linearis]) HSP 1 Score: 57.0 bits (136), Expect = 6.0e-05 Identity = 29/50 (58.00%), Postives = 34/50 (68.00%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. NCBI nr
Match: YP_009771901.1 (RNA polymerase beta subunit [Sphinga acatlensis] >QIT02686.1 RNA polymerase beta subunit [Sphinga acatlensis]) HSP 1 Score: 57.0 bits (136), Expect = 6.0e-05 Identity = 29/50 (58.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. NCBI nr
Match: YP_009383303.1 (RNA polymerase beta subunit [Pithecellobium flexicaule] >APA33419.1 RNA polymerase beta subunit [Pithecellobium flexicaule]) HSP 1 Score: 57.0 bits (136), Expect = 6.0e-05 Identity = 29/50 (58.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy Swiss-Prot
Match: A9LYH7 (DNA-directed RNA polymerase subunit beta OS=Acorus americanus OX=263995 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.1e-06 Identity = 27/48 (56.25%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy Swiss-Prot
Match: Q3V542 (DNA-directed RNA polymerase subunit beta OS=Acorus calamus OX=4465 GN=rpoB PE=3 SV=2) HSP 1 Score: 53.1 bits (126), Expect = 1.1e-06 Identity = 27/48 (56.25%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy Swiss-Prot
Match: Q5QA72 (DNA-directed RNA polymerase subunit beta OS=Acorus gramineus OX=55184 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.1e-06 Identity = 27/48 (56.25%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy Swiss-Prot
Match: Q8S8X9 (DNA-directed RNA polymerase subunit beta OS=Atropa belladonna OX=33113 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.1e-06 Identity = 27/48 (56.25%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy Swiss-Prot
Match: Q7YJX8 (DNA-directed RNA polymerase subunit beta OS=Calycanthus floridus var. glaucus OX=212734 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.1e-06 Identity = 27/48 (56.25%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy TrEMBL
Match: A0A0A0LEN8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G815480 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 1.8e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy TrEMBL
Match: A0A4Y7LAN4 (DNA-directed RNA polymerase subunit beta OS=Papaver somniferum OX=3469 GN=C5167_043860 PE=3 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 1.7e-05 Identity = 29/48 (60.42%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy TrEMBL
Match: A0A1D0C241 (DNA-directed RNA polymerase subunit beta OS=Acacia inceana subsp. conformis OX=1173652 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.9e-05 Identity = 29/50 (58.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy TrEMBL
Match: A0A291EZ27 (DNA-directed RNA polymerase subunit beta OS=Lobelia linearis OX=2041131 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.9e-05 Identity = 29/50 (58.00%), Postives = 34/50 (68.00%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. ExPASy TrEMBL
Match: A0A6H0EMV9 (DNA-directed RNA polymerase subunit beta OS=Sphinga acatlensis OX=468161 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.9e-05 Identity = 29/50 (58.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of CsaV3_3G039630 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 52.0 bits (123), Expect = 1.8e-07 Identity = 26/48 (54.17%), Postives = 33/48 (68.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|