CsaV3_1G038070 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGACGAAGGAACAACAAATTGCATCGATATCCTCCTCGCTATTCTCCTCCCTCCTCTTGGTGTCTTTCTCAAATTTGGATGCCAAGTCTGATAATCATCTCTTAACTTTATTTTTCATTTTCAAATCCCATTATTTCACTAACTCTCTCTTTTAATCACTTCATAATTTCAGGTTGAGTTTTGGATCTGCTTGGTCTTAACTTTCTTTGGTTACATCCCTGGCATTATTTATGCTGTTTATGCCATCACCAAGTGA ATGGCAGACGAAGGAACAACAAATTGCATCGATATCCTCCTCGCTATTCTCCTCCCTCCTCTTGGTGTCTTTCTCAAATTTGGATGCCAAGTTGAGTTTTGGATCTGCTTGGTCTTAACTTTCTTTGGTTACATCCCTGGCATTATTTATGCTGTTTATGCCATCACCAAGTGA ATGGCAGACGAAGGAACAACAAATTGCATCGATATCCTCCTCGCTATTCTCCTCCCTCCTCTTGGTGTCTTTCTCAAATTTGGATGCCAAGTTGAGTTTTGGATCTGCTTGGTCTTAACTTTCTTTGGTTACATCCCTGGCATTATTTATGCTGTTTATGCCATCACCAAGTGA MADEGTTNCIDILLAILLPPLGVFLKFGCQVEFWICLVLTFFGYIPGIIYAVYAITK* Homology
BLAST of CsaV3_1G038070 vs. NCBI nr
Match: KGN65991.1 (hypothetical protein Csa_007015 [Cucumis sativus]) HSP 1 Score: 119.4 bits (298), Expect = 1.0e-23 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. NCBI nr
Match: XP_038879764.1 (hydrophobic protein LTI6B-like [Benincasa hispida]) HSP 1 Score: 117.1 bits (292), Expect = 5.1e-23 Identity = 56/57 (98.25%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. NCBI nr
Match: XP_008450512.1 (PREDICTED: hydrophobic protein LTI6B-like [Cucumis melo]) HSP 1 Score: 116.3 bits (290), Expect = 8.7e-23 Identity = 56/57 (98.25%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. NCBI nr
Match: XP_004494506.1 (hydrophobic protein LTI6B-like [Cicer arietinum]) HSP 1 Score: 115.2 bits (287), Expect = 1.9e-22 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. NCBI nr
Match: XP_038705733.1 (hydrophobic protein LTI6B-like [Tripterygium wilfordii]) HSP 1 Score: 113.2 bits (282), Expect = 7.4e-22 Identity = 53/57 (92.98%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy Swiss-Prot
Match: A2Y075 (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica OX=39946 GN=LTI6B PE=3 SV=2) HSP 1 Score: 98.6 bits (244), Expect = 2.5e-20 Identity = 45/53 (84.91%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy Swiss-Prot
Match: Q0DKW8 (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica OX=39947 GN=LTI6B PE=2 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.5e-20 Identity = 45/53 (84.91%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy Swiss-Prot
Match: Q8H5T6 (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica OX=39947 GN=LTI6A PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 4.7e-19 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy Swiss-Prot
Match: Q9ZNS6 (Hydrophobic protein RCI2B OS=Arabidopsis thaliana OX=3702 GN=RCI2B PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 4.4e-17 Identity = 38/52 (73.08%), Postives = 47/52 (90.38%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy Swiss-Prot
Match: Q9ZNQ7 (Hydrophobic protein RCI2A OS=Arabidopsis thaliana OX=3702 GN=RCI2A PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 7.4e-17 Identity = 39/52 (75.00%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy TrEMBL
Match: A0A0A0M1D6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G560745 PE=3 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 5.0e-24 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy TrEMBL
Match: A0A1S3BNR9 (hydrophobic protein LTI6B-like OS=Cucumis melo OX=3656 GN=LOC103492093 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 4.2e-23 Identity = 56/57 (98.25%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy TrEMBL
Match: A0A1S2XTZ3 (hydrophobic protein LTI6B-like OS=Cicer arietinum OX=3827 GN=LOC101498830 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 9.4e-23 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy TrEMBL
Match: A0A4Y7IL50 (Uncharacterized protein OS=Papaver somniferum OX=3469 GN=C5167_017259 PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 4.7e-22 Identity = 51/57 (89.47%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. ExPASy TrEMBL
Match: A0A2K3L766 (Hydrophobic protein LTI6A-like OS=Trifolium pratense OX=57577 GN=L195_g030288 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 6.1e-22 Identity = 53/57 (92.98%), Postives = 54/57 (94.74%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. TAIR 10
Match: AT3G05890.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 87.8 bits (216), Expect = 3.1e-18 Identity = 38/52 (73.08%), Postives = 47/52 (90.38%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. TAIR 10
Match: AT3G05880.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 87.0 bits (214), Expect = 5.3e-18 Identity = 39/52 (75.00%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. TAIR 10
Match: AT2G38905.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 78.6 bits (192), Expect = 1.9e-15 Identity = 34/51 (66.67%), Postives = 44/51 (86.27%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. TAIR 10
Match: AT1G57550.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 69.3 bits (168), Expect = 1.1e-12 Identity = 27/48 (56.25%), Postives = 41/48 (85.42%), Query Frame = 0
BLAST of CsaV3_1G038070 vs. TAIR 10
Match: AT4G28088.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 66.2 bits (160), Expect = 9.6e-12 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|