
CsGy7G001875 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGAATTGGGAGATTGCAGCATCTGTTTGGATGAATTGAGTTGTGAAAAGAGGGAGGTGATGAGGATTCCTTGTGGCCATGTTTACCATGAATCGTGCATCTTCAAGTGGCTTGAGAATCACAATTCTTGTCCTTTGTGTAGAAAGCCATTGCACCACGACGACGACGACGAGGAGGAGTACTCATGGTGA ATGGAGGAATTGGGAGATTGCAGCATCTGTTTGGATGAATTGAGTTGTGAAAAGAGGGAGGTGATGAGGATTCCTTGTGGCCATGTTTACCATGAATCGTGCATCTTCAAGTGGCTTGAGAATCACAATTCTTGTCCTTTGTGTAGAAAGCCATTGCACCACGACGACGACGACGAGGAGGAGTACTCATGGTGA ATGGAGGAATTGGGAGATTGCAGCATCTGTTTGGATGAATTGAGTTGTGAAAAGAGGGAGGTGATGAGGATTCCTTGTGGCCATGTTTACCATGAATCGTGCATCTTCAAGTGGCTTGAGAATCACAATTCTTGTCCTTTGTGTAGAAAGCCATTGCACCACGACGACGACGACGAGGAGGAGTACTCATGGTGA MEELGDCSICLDELSCEKREVMRIPCGHVYHESCIFKWLENHNSCPLCRKPLHHDDDDEEEYSW* Homology
BLAST of CsGy7G001875 vs. ExPASy Swiss-Prot
Match: Q8LPN7 (E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana OX=3702 GN=At3g19950 PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 8.1e-12 Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy Swiss-Prot
Match: P0CH30 (E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum OX=3635 GN=RING1 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 1.8e-11 Identity = 27/58 (46.55%), Postives = 37/58 (63.79%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy Swiss-Prot
Match: Q9VHI7 (E3 ubiquitin-protein ligase Iruka OS=Drosophila melanogaster OX=7227 GN=Iru PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.0e-10 Identity = 25/55 (45.45%), Postives = 38/55 (69.09%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy Swiss-Prot
Match: Q9Y7K6 (Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2A9.04c PE=4 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 4.4e-10 Identity = 22/50 (44.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy Swiss-Prot
Match: Q6AXU4 (E3 ubiquitin-protein ligase RNF181 OS=Rattus norvegicus OX=10116 GN=Rnf181 PE=1 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 5.8e-10 Identity = 27/56 (48.21%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of CsGy7G001875 vs. NCBI nr
Match: XP_011659694.1 (E3 ubiquitin-protein ligase RDUF1 [Cucumis sativus] >KGN43356.1 hypothetical protein Csa_020163 [Cucumis sativus]) HSP 1 Score: 148 bits (374), Expect = 4.51e-43 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of CsGy7G001875 vs. NCBI nr
Match: XP_004144954.1 (uncharacterized protein LOC101214496 [Cucumis sativus] >KGN43349.1 hypothetical protein Csa_020356 [Cucumis sativus]) HSP 1 Score: 145 bits (367), Expect = 5.17e-42 Identity = 62/64 (96.88%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of CsGy7G001875 vs. NCBI nr
Match: XP_016899530.1 (PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Cucumis melo] >KAA0035774.1 E3 ubiquitin-protein ligase RNF181-like protein [Cucumis melo var. makuwa] >TYK29842.1 E3 ubiquitin-protein ligase RNF181-like protein [Cucumis melo var. makuwa]) HSP 1 Score: 118 bits (295), Expect = 3.77e-31 Identity = 51/63 (80.95%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of CsGy7G001875 vs. NCBI nr
Match: XP_038883574.1 (E3 ubiquitin-protein ligase RNF181-like [Benincasa hispida]) HSP 1 Score: 108 bits (271), Expect = 1.42e-27 Identity = 46/56 (82.14%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of CsGy7G001875 vs. NCBI nr
Match: XP_016901482.1 (PREDICTED: uncharacterized protein LOC107991269 [Cucumis melo] >KAA0044413.1 E3 ubiquitin-protein ligase RNF181-like protein [Cucumis melo var. makuwa] >TYK29540.1 E3 ubiquitin-protein ligase RNF181-like protein [Cucumis melo var. makuwa]) HSP 1 Score: 97.8 bits (242), Expect = 2.87e-23 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy TrEMBL
Match: A0A0A0K696 (RING-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G026750 PE=4 SV=1) HSP 1 Score: 148 bits (374), Expect = 2.18e-43 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy TrEMBL
Match: A0A0A0K2W2 (RING-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G025210 PE=4 SV=1) HSP 1 Score: 145 bits (367), Expect = 2.50e-42 Identity = 62/64 (96.88%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy TrEMBL
Match: A0A5D3E1S5 (E3 ubiquitin-protein ligase RNF181-like protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold208G00800 PE=4 SV=1) HSP 1 Score: 118 bits (295), Expect = 1.83e-31 Identity = 51/63 (80.95%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy TrEMBL
Match: A0A1S4DUZ4 (E3 ubiquitin-protein ligase RNF181-like OS=Cucumis melo OX=3656 GN=LOC107990564 PE=4 SV=1) HSP 1 Score: 118 bits (295), Expect = 1.83e-31 Identity = 51/63 (80.95%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of CsGy7G001875 vs. ExPASy TrEMBL
Match: A0A0A0KYC0 (RING-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G003650 PE=4 SV=1) HSP 1 Score: 102 bits (254), Expect = 1.36e-25 Identity = 44/54 (81.48%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of CsGy7G001875 vs. TAIR 10
Match: AT3G19950.1 (RING/U-box superfamily protein ) HSP 1 Score: 70.5 bits (171), Expect = 5.7e-13 Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of CsGy7G001875 vs. TAIR 10
Match: AT5G37200.1 (RING/U-box superfamily protein ) HSP 1 Score: 69.3 bits (168), Expect = 1.3e-12 Identity = 29/62 (46.77%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of CsGy7G001875 vs. TAIR 10
Match: AT1G57730.1 (RING/U-box superfamily protein ) HSP 1 Score: 65.9 bits (159), Expect = 1.4e-11 Identity = 26/57 (45.61%), Postives = 38/57 (66.67%), Query Frame = 0
BLAST of CsGy7G001875 vs. TAIR 10
Match: AT3G56580.2 (RING/U-box superfamily protein ) HSP 1 Score: 63.2 bits (152), Expect = 9.1e-11 Identity = 24/46 (52.17%), Postives = 29/46 (63.04%), Query Frame = 0
BLAST of CsGy7G001875 vs. TAIR 10
Match: AT3G56580.1 (RING/U-box superfamily protein ) HSP 1 Score: 63.2 bits (152), Expect = 9.1e-11 Identity = 24/46 (52.17%), Postives = 29/46 (63.04%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|