CsGy6G025720 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCTCATGTAATTTTTGGAGATTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGGAATGGGAGAATTTCAAGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGA ATGTCTTCTCATGTAATTTTTGGAGATTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGGAATGGGAGAATTTCAAGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGA ATGTCTTCTCATGTAATTTTTGGAGATTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGGAATGGGAGAATTTCAAGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGA MSSHVIFGDYRPCENSDGPHAKEVAQWAVTEYNLKHRHERPYLYLLSVLKCESQVVAGTNWRLGLKCKDENNIEVNCEAVVWEKEWENFKELTSFIVFYPSSG* Homology
BLAST of CsGy6G025720 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 75.5 bits (184), Expect = 4.0e-13 Identity = 41/91 (45.05%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.5e-12 Identity = 40/91 (43.96%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 6.4e-11 Identity = 33/88 (37.50%), Postives = 50/88 (56.82%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy Swiss-Prot
Match: P31726 (Cystatin-1 OS=Zea mays OX=4577 GN=RAMDAZC7 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.9e-07 Identity = 32/81 (39.51%), Postives = 48/81 (59.26%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 56.6 bits (135), Expect = 1.9e-07 Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 0
BLAST of CsGy6G025720 vs. NCBI nr
Match: KAE8645927.1 (hypothetical protein Csa_021385 [Cucumis sativus]) HSP 1 Score: 219 bits (559), Expect = 3.08e-72 Identity = 100/103 (97.09%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of CsGy6G025720 vs. NCBI nr
Match: KGN44121.2 (hypothetical protein Csa_021373 [Cucumis sativus]) HSP 1 Score: 218 bits (556), Expect = 8.84e-72 Identity = 98/103 (95.15%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of CsGy6G025720 vs. NCBI nr
Match: KAE8647447.1 (hypothetical protein Csa_003984 [Cucumis sativus]) HSP 1 Score: 211 bits (537), Expect = 7.01e-69 Identity = 97/103 (94.17%), Postives = 98/103 (95.15%), Query Frame = 0
BLAST of CsGy6G025720 vs. NCBI nr
Match: XP_031742547.1 (cysteine proteinase inhibitor 1-like [Cucumis sativus] >KAE8647445.1 hypothetical protein Csa_003720 [Cucumis sativus]) HSP 1 Score: 208 bits (529), Expect = 1.17e-67 Identity = 94/103 (91.26%), Postives = 96/103 (93.20%), Query Frame = 0
BLAST of CsGy6G025720 vs. NCBI nr
Match: KAE8645925.1 (hypothetical protein Csa_021376 [Cucumis sativus]) HSP 1 Score: 207 bits (528), Expect = 1.66e-67 Identity = 94/103 (91.26%), Postives = 96/103 (93.20%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy TrEMBL
Match: A0A0A0KHK7 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G459990 PE=4 SV=1) HSP 1 Score: 210 bits (534), Expect = 9.74e-69 Identity = 95/103 (92.23%), Postives = 97/103 (94.17%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy TrEMBL
Match: A0A0A0KF17 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G460000 PE=4 SV=1) HSP 1 Score: 203 bits (517), Expect = 3.83e-66 Identity = 93/103 (90.29%), Postives = 95/103 (92.23%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy TrEMBL
Match: O80389 (Cystein proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 120 bits (302), Expect = 1.86e-33 Identity = 58/95 (61.05%), Postives = 70/95 (73.68%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy TrEMBL
Match: A0A5A7TBL3 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold529G00310 PE=4 SV=1) HSP 1 Score: 108 bits (270), Expect = 1.30e-28 Identity = 55/95 (57.89%), Postives = 66/95 (69.47%), Query Frame = 0
BLAST of CsGy6G025720 vs. ExPASy TrEMBL
Match: A0A5A7SJM4 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold253G00050 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.85e-23 Identity = 45/88 (51.14%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of CsGy6G025720 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 68.2 bits (165), Expect = 4.5e-12 Identity = 33/88 (37.50%), Postives = 50/88 (56.82%), Query Frame = 0
BLAST of CsGy6G025720 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 54.3 bits (129), Expect = 6.8e-08 Identity = 34/84 (40.48%), Postives = 44/84 (52.38%), Query Frame = 0
BLAST of CsGy6G025720 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-07 Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 0
BLAST of CsGy6G025720 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 53.1 bits (126), Expect = 1.5e-07 Identity = 28/81 (34.57%), Postives = 45/81 (55.56%), Query Frame = 0
BLAST of CsGy6G025720 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 49.7 bits (117), Expect = 1.7e-06 Identity = 31/81 (38.27%), Postives = 43/81 (53.09%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|