Cp4.1LG13g07840 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGTCATTAGCCGCCGCTGCCGCCCCCGCCGCCATGGAAACCGGCCATCACCACCTCTGGAACACTCCGATACCATATCTCTTCGGCGGAATAGGCCTAACTCTACTTCTCATCCTCACCGCATTGATTTTACTCACTTGTTCCTGCCGGAAACTCTCTTCATCTTCACCTTCTTCATCGTCTTCCGAAGAAGAAGACCAGAAGACGAAGATCGATACTCCTGCAAAAACGGCCGCCGATCTGAAACCTCAAATCGTCGTCATAATGGCCGGAAATAACACGCCGTCGTTCCTCGCCACCGCTACGCCTTCCGATTCTTCTACTTTTTCTCGATCGAACCAGCAGTTCTGA ATGAGGTCATTAGCCGCCGCTGCCGCCCCCGCCGCCATGGAAACCGGCCATCACCACCTCTGGAACACTCCGATACCATATCTCTTCGGCGGAATAGGCCTAACTCTACTTCTCATCCTCACCGCATTGATTTTACTCACTTGTTCCTGCCGGAAACTCTCTTCATCTTCACCTTCTTCATCGTCTTCCGAAGAAGAAGACCAGAAGACGAAGATCGATACTCCTGCAAAAACGGCCGCCGATCTGAAACCTCAAATCGTCGTCATAATGGCCGGAAATAACACGCCGTCGTTCCTCGCCACCGCTACGCCTTCCGATTCTTCTACTTTTTCTCGATCGAACCAGCAGTTCTGA ATGAGGTCATTAGCCGCCGCTGCCGCCCCCGCCGCCATGGAAACCGGCCATCACCACCTCTGGAACACTCCGATACCATATCTCTTCGGCGGAATAGGCCTAACTCTACTTCTCATCCTCACCGCATTGATTTTACTCACTTGTTCCTGCCGGAAACTCTCTTCATCTTCACCTTCTTCATCGTCTTCCGAAGAAGAAGACCAGAAGACGAAGATCGATACTCCTGCAAAAACGGCCGCCGATCTGAAACCTCAAATCGTCGTCATAATGGCCGGAAATAACACGCCGTCGTTCCTCGCCACCGCTACGCCTTCCGATTCTTCTACTTTTTCTCGATCGAACCAGCAGTTCTGA MRSLAAAAAPAAMETGHHHLWNTPIPYLFGGIGLTLLLILTALILLTCSCRKLSSSSPSSSSSEEEDQKTKIDTPAKTAADLKPQIVVIMAGNNTPSFLATATPSDSSTFSRSNQQF Homology
BLAST of Cp4.1LG13g07840 vs. ExPASy Swiss-Prot
Match: Q8S8A0 (Protein GLUTAMINE DUMPER 4 OS=Arabidopsis thaliana OX=3702 GN=GDU4 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 3.3e-08 Identity = 34/81 (41.98%), Postives = 55/81 (67.90%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy Swiss-Prot
Match: Q3EAV6 (Protein GLUTAMINE DUMPER 6 OS=Arabidopsis thaliana OX=3702 GN=GDU6 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 3.3e-08 Identity = 40/93 (43.01%), Postives = 57/93 (61.29%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy Swiss-Prot
Match: Q3E965 (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana OX=3702 GN=GDU5 PE=2 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.8e-07 Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy Swiss-Prot
Match: Q9SW07 (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana OX=3702 GN=GDU2 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 4.8e-07 Identity = 37/92 (40.22%), Postives = 55/92 (59.78%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy Swiss-Prot
Match: O81775 (Protein GLUTAMINE DUMPER 1 OS=Arabidopsis thaliana OX=3702 GN=GDU1 PE=1 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 8.2e-07 Identity = 32/81 (39.51%), Postives = 51/81 (62.96%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. NCBI nr
Match: KAG6578523.1 (Protein GLUTAMINE DUMPER 4, partial [Cucurbita argyrosperma subsp. sororia] >KAG7016084.1 Protein GLUTAMINE DUMPER 4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 204 bits (520), Expect = 7.37e-66 Identity = 111/117 (94.87%), Postives = 113/117 (96.58%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. NCBI nr
Match: KAG6602552.1 (Protein GLUTAMINE DUMPER 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7033232.1 Protein GLUTAMINE DUMPER 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 151 bits (381), Expect = 1.03e-44 Identity = 83/117 (70.94%), Postives = 97/117 (82.91%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. NCBI nr
Match: XP_023545008.1 (protein GLUTAMINE DUMPER 6-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 146 bits (368), Expect = 9.22e-43 Identity = 83/117 (70.94%), Postives = 96/117 (82.05%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. NCBI nr
Match: KAA0039409.1 (protein GLUTAMINE DUMPER 6-like [Cucumis melo var. makuwa] >TYK00596.1 protein GLUTAMINE DUMPER 6-like [Cucumis melo var. makuwa]) HSP 1 Score: 93.6 bits (231), Expect = 4.13e-22 Identity = 60/98 (61.22%), Postives = 67/98 (68.37%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. NCBI nr
Match: XP_022949049.1 (protein GLUTAMINE DUMPER 6-like [Cucurbita moschata]) HSP 1 Score: 78.6 bits (192), Expect = 6.73e-16 Identity = 50/101 (49.50%), Postives = 65/101 (64.36%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy TrEMBL
Match: A0A5D3BQQ1 (Protein GLUTAMINE DUMPER 6-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold169G002130 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 2.00e-22 Identity = 60/98 (61.22%), Postives = 67/98 (68.37%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy TrEMBL
Match: A0A6J1GBQ1 (protein GLUTAMINE DUMPER 6-like OS=Cucurbita moschata OX=3662 GN=LOC111452513 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 3.26e-16 Identity = 50/101 (49.50%), Postives = 65/101 (64.36%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy TrEMBL
Match: A0A7J7DR65 (Uncharacterized protein OS=Tripterygium wilfordii OX=458696 GN=HS088_TW04G00853 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.19e-15 Identity = 42/98 (42.86%), Postives = 66/98 (67.35%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy TrEMBL
Match: A0A2R6P9V1 (Protein GLUTAMINE DUMPER like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc30812 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.60e-15 Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. ExPASy TrEMBL
Match: A0A7N2KXR5 (Uncharacterized protein OS=Quercus lobata OX=97700 PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.83e-14 Identity = 45/101 (44.55%), Postives = 66/101 (65.35%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. TAIR 10
Match: AT2G24762.1 (glutamine dumper 4 ) HSP 1 Score: 59.3 bits (142), Expect = 2.4e-09 Identity = 34/81 (41.98%), Postives = 55/81 (67.90%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. TAIR 10
Match: AT3G30725.1 (glutamine dumper 6 ) HSP 1 Score: 59.3 bits (142), Expect = 2.4e-09 Identity = 40/93 (43.01%), Postives = 57/93 (61.29%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. TAIR 10
Match: AT5G24920.1 (glutamine dumper 5 ) HSP 1 Score: 56.2 bits (134), Expect = 2.0e-08 Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. TAIR 10
Match: AT4G25760.1 (glutamine dumper 2 ) HSP 1 Score: 55.5 bits (132), Expect = 3.4e-08 Identity = 37/92 (40.22%), Postives = 55/92 (59.78%), Query Frame = 0
BLAST of Cp4.1LG13g07840 vs. TAIR 10
Match: AT4G31730.1 (glutamine dumper 1 ) HSP 1 Score: 54.7 bits (130), Expect = 5.9e-08 Identity = 32/81 (39.51%), Postives = 51/81 (62.96%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|