Cp4.1LG12g07010 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCGCACCAAGCAAACCGCCAGGAAATCCACCGGAGGCAAGGCCCCAAGGAAGCAACTAGCCACCAAAGCCGCCCGGAAGTCCGCTCCAGCCACCGGTGGAGTGAAGAAGCCCCACCGCTTCCGCCCTGGAACCGTCGCGCTTCGTGAGATTCGTAAGTACCAAAAGAGCACAGAGCTCTTAATCCGCAAACTTCCATTTCAACGATTGGTTCGTGAGATCGCACAAGATTTCAAGACCGATCTGAGATTCCAAAGCAGCGCGGTATCGGCTCTGCAGGAGGCGGCAGAGGCCTATTTAGTTGGTCTGTTCGAAGACACGAATCTGTGTGCGATTCATGCGAAGAGAGTCACAATCATGCCAAAGGACATTCAATTGGCCAGGAGGATTAGAGGCGAGAGGGCTTGAATGGCTCGCACCAAGCAAACCGCCAGGAAATCCACCGGAGGCAAGGCCCCAAGGAAGCAACTAGCCACCAAAGCCGCCCGGAAGTCCGCTCCAGCCACCGGTGGAGTGAAGAAGCCCCACCGCTTCCGCCCTGGAACCGTCGCGCTTCGTGAGATTCGTAAGTACCAAAAGAGCACAGAGCTCTTAATCCGCAAACTTCCATTTCAACGATTGGTTCGTGAGATCGCACAAGATTTCAAGACCGATCTGAGATTCCAAAGCAGCGCGGTATCGGCTCTGCAGGAGGCGGCAGAGGCCTATTTAGTTGGTCTGTTCGAAGACACGAATCTGTGTGCGATTCATGCGAAGAGAGTCACAATCATGCCAAAGGACATTCAATTGGCCAGGAGGATTAGAGGCGAGAGGGCTTGA ATGGCTCGCACCAAGCAAACCGCCAGGAAATCCACCGGAGGCAAGGCCCCAAGGAAGCAACTAGCCACCAAAGCCGCCCGGAAGTCCGCTCCAGCCACCGGTGGAGTGAAGAAGCCCCACCGCTTCCGCCCTGGAACCGTCGCGCTTCGTGAGATTCGTAAGTACCAAAAGAGCACAGAGCTCTTAATCCGCAAACTTCCATTTCAACGATTGGTTCGTGAGATCGCACAAGATTTCAAGACCGATCTGAGATTCCAAAGCAGCGCGGTATCGGCTCTGCAGGAGGCGGCAGAGGCCTATTTAGTTGGTCTGTTCGAAGACACGAATCTGTGTGCGATTCATGCGAAGAGAGTCACAATCATGCCAAAGGACATTCAATTGGCCAGGAGGATTAGAGGCGAGAGGGCTTGA MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Homology
BLAST of Cp4.1LG12g07010 vs. ExPASy Swiss-Prot
Match: P68429 (Histone H3.2 OS=Medicago sativa OX=3879 GN=H3-1.1 PE=1 SV=2) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy Swiss-Prot
Match: P68430 (Histone H3.2 OS=Onobrychis viciifolia OX=3882 PE=2 SV=2) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy Swiss-Prot
Match: P68427 (Histone H3.2 OS=Pisum sativum OX=3888 PE=1 SV=2) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy Swiss-Prot
Match: P68428 (Histone H3.2 OS=Triticum aestivum OX=4565 PE=1 SV=2) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy Swiss-Prot
Match: P59226 (Histone H3.2 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2) HSP 1 Score: 252.3 bits (643), Expect = 3.1e-66 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. NCBI nr
Match: NP_001238509.1 (histone H3.2 [Glycine max] >NP_001311089.1 Histone H3.2 [Zea mays] >XP_003529355.1 histone H3.2 [Glycine max] >XP_003531787.1 histone H3.2 [Glycine max] >XP_003531853.1 histone H3.2 [Glycine max] >XP_003537953.1 histone H3.2 [Glycine max] >XP_003539404.1 histone H3.2 [Glycine max] >XP_003542714.1 histone H3.2 [Glycine max] >XP_003546675.1 histone H3.2 [Glycine max] >XP_003557185.1 histone H3.2 [Brachypodium distachyon] >XP_003564281.1 histone H3.2 [Brachypodium distachyon] >XP_003568367.1 histone H3.2 [Brachypodium distachyon] >XP_003575094.1 histone H3.2 [Brachypodium distachyon] >XP_003594840.2 histone H3.2 [Medicago truncatula] >XP_003612851.2 histone H3.2 [Medicago truncatula] >XP_003612856.1 histone H3.2 [Medicago truncatula] >XP_003622981.1 histone H3.2 [Medicago truncatula] >XP_003628691.1 histone H3.2 [Medicago truncatula] >XP_003630185.1 histone H3.2 [Medicago truncatula] >XP_003630195.2 histone H3.2 [Medicago truncatula] >XP_004140867.1 histone H3.2 [Cucumis sativus] >XP_004488709.1 histone H3.2 [Cicer arietinum] >XP_004489510.1 histone H3.2 [Cicer arietinum] >XP_004489511.1 histone H3.2 [Cicer arietinum] >XP_004489512.1 histone H3.2 [Cicer arietinum] >XP_004503973.1 histone H3.2 [Cicer arietinum] >XP_004505111.1 histone H3.2 [Cicer arietinum] >XP_006383727.1 histone H3.2 [Populus trichocarpa] >XP_006595049.1 histone H3.2 [Glycine max] >XP_006597243.1 histone H3.2 [Glycine max] >XP_007131986.1 hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris] >XP_007133533.1 hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris] >XP_007139488.1 hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris] >XP_007153894.1 hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris] >XP_007159809.1 hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris] >XP_007159810.1 hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris] >XP_008384522.1 histone H3.2 [Malus domestica] >XP_008384524.1 histone H3.2 [Malus domestica] >XP_008445689.1 PREDICTED: histone H3.2 [Cucumis melo] >XP_008657023.1 histone H3.2 [Zea mays] >XP_008784458.1 histone H3.2 [Phoenix dactylifera] >XP_008785823.1 histone H3.2 [Phoenix dactylifera] >XP_009374750.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009379418.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009379421.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009414586.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_010025543.1 histone H3.2 [Eucalyptus grandis] >XP_010025545.1 histone H3.2 [Eucalyptus grandis] >XP_010231094.1 histone H3.2 [Brachypodium distachyon] >XP_010231492.1 histone H3.2 [Brachypodium distachyon] >XP_010237279.1 histone H3.2 [Brachypodium distachyon] >XP_010246200.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010523315.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] >XP_010928463.1 histone H3.2 [Elaeis guineensis] >XP_011014732.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011045162.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_013447325.1 histone H3.2 [Medicago truncatula] >XP_013456228.1 histone H3.2 [Medicago truncatula] >XP_013456925.1 histone H3.2 [Medicago truncatula] >XP_014492217.1 histone H3.2 [Vigna radiata var. radiata] >XP_014494055.1 histone H3.2 [Vigna radiata var. radiata] >XP_014497676.1 histone H3.2 [Vigna radiata var. radiata] >XP_015935473.1 histone H3.2 [Arachis duranensis] >XP_015945894.1 histone H3.2 [Arachis duranensis] >XP_015952173.1 histone H3.2 [Arachis duranensis] >XP_016171059.1 histone H3.2 [Arachis ipaensis] >XP_016187161.1 histone H3.2 [Arachis ipaensis] >XP_017409105.1 PREDICTED: histone H3.2 [Vigna angularis] >XP_017410882.1 PREDICTED: histone H3.2 [Vigna angularis] >XP_017425736.1 PREDICTED: histone H3.2 [Vigna angularis] >XP_017433240.1 PREDICTED: histone H3.2 [Vigna angularis] >XP_017436757.1 PREDICTED: histone H3.2 [Vigna angularis] >XP_017436770.1 PREDICTED: histone H3.2 [Vigna angularis] >XP_018830869.1 histone H3.2 [Juglans regia] >XP_018851509.1 histone H3.2 [Juglans regia] >XP_019417246.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019417898.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019424439.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019434508.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019437230.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019445693.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019448294.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019457693.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019457694.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019462708.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_019463783.1 PREDICTED: histone H3.2 [Lupinus angustifolius] >XP_020147519.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020147521.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020148653.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020152971.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020156190.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020159543.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020164950.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020167501.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020168907.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020168911.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020168913.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020174885.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020176163.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020176164.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020176165.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020180106.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020180107.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020181396.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020183600.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020183994.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020195754.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020199154.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020201310.1 histone H3.2 [Aegilops tauschii subsp. strangulata] >XP_020214134.1 histone H3.2 [Cajanus cajan] >XP_020215283.1 histone H3.2 [Cajanus cajan] >XP_020215284.1 histone H3.2 [Cajanus cajan] >XP_020218992.1 histone H3.2 [Cajanus cajan] >XP_020223151.1 histone H3.2 [Cajanus cajan] >XP_020223261.1 histone H3.2 [Cajanus cajan] >XP_020524217.1 histone H3.2 [Amborella trichopoda] >XP_022154130.1 histone H3.2 [Momordica charantia] >XP_022954335.1 histone H3.2 [Cucurbita moschata] >XP_022959729.1 histone H3.2 [Cucurbita moschata] >XP_022991937.1 histone H3.2 [Cucurbita maxima] >XP_023004689.1 histone H3.2 [Cucurbita maxima] >XP_023514058.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023549252.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023916465.1 histone H3.2 [Quercus suber] >XP_025613813.1 histone H3.2 [Arachis hypogaea] >XP_025642131.1 histone H3.2 [Arachis hypogaea] >XP_025671857.1 histone H3.2 [Arachis hypogaea] >XP_025686286.1 histone H3.2 [Arachis hypogaea] >XP_027340493.1 histone H3.2 [Abrus precatorius] >XP_027345201.1 histone H3.2 [Abrus precatorius] >XP_027354108.1 histone H3.2 [Abrus precatorius] >XP_027357078.1 histone H3.2 [Abrus precatorius] >XP_027906760.1 histone H3.2 [Vigna unguiculata] >XP_027908903.1 histone H3.2 [Vigna unguiculata] >XP_027911936.1 histone H3.2 [Vigna unguiculata] >XP_027918839.1 histone H3.2 [Vigna unguiculata] >XP_027918840.1 histone H3.2 [Vigna unguiculata] >XP_027925716.1 histone H3.2 [Vigna unguiculata] >XP_027927081.1 histone H3.2 [Vigna unguiculata] >XP_027928141.1 histone H3.2 [Vigna unguiculata] >XP_028189583.1 histone H3.2 [Glycine soja] >XP_028190934.1 histone H3.2 [Glycine soja] >XP_028191389.1 histone H3.2 [Glycine soja] >XP_028195498.1 histone H3.2 [Glycine soja] >XP_028202444.1 histone H3.2 [Glycine soja] >XP_028204522.1 histone H3.2 [Glycine soja] >XP_028215537.1 histone H3.2 [Glycine soja] >XP_028241112.1 histone H3.2 [Glycine soja] >XP_028244796.1 histone H3.2 [Glycine soja] >XP_028244987.1 histone H3.2 [Glycine soja] >XP_029127326.1 histone H3.2 [Cajanus cajan] >XP_030445978.1 histone H3.2 [Syzygium oleosum] >XP_030486065.1 histone H3.2 [Cannabis sativa] >XP_030486066.1 histone H3.2 [Cannabis sativa] >XP_030506090.1 histone H3.2 [Cannabis sativa] >XP_030506295.1 histone H3.2 [Cannabis sativa] >XP_030952980.1 histone H3.2 [Quercus lobata] >XP_034931661.1 histone H3.2 [Populus alba] >XP_037404805.1 histone H3.2 [Triticum dicoccoides] >XP_037407496.1 histone H3.2 [Triticum dicoccoides] >XP_037413587.1 histone H3.2 [Triticum dicoccoides] >XP_037417579.1 histone H3.2 [Triticum dicoccoides] >XP_037419750.1 histone H3.2 [Triticum dicoccoides] >XP_037420004.1 histone H3.2 [Triticum dicoccoides] >XP_037423203.1 histone H3.2 [Triticum dicoccoides] >XP_037423206.1 histone H3.2 [Triticum dicoccoides] >XP_037424247.1 histone H3.2 [Triticum dicoccoides] >XP_037424268.1 histone H3.2 [Triticum dicoccoides] >XP_037425829.1 histone H3.2 [Triticum dicoccoides] >XP_037426132.1 histone H3.2 [Triticum dicoccoides] >XP_037440982.1 histone H3.2 [Triticum dicoccoides] >XP_037445013.1 histone H3.2 [Triticum dicoccoides] >XP_037445033.1 histone H3.2 [Triticum dicoccoides] >XP_037445610.1 histone H3.2 [Triticum dicoccoides] >XP_037446561.1 histone H3.2 [Triticum dicoccoides] >XP_037452555.1 histone H3.2 [Triticum dicoccoides] >XP_037452913.1 histone H3.2 [Triticum dicoccoides] >XP_037453239.1 histone H3.2 [Triticum dicoccoides] >XP_037454388.1 histone H3.2 [Triticum dicoccoides] >XP_037457336.1 histone H3.2 [Triticum dicoccoides] >XP_037458222.1 histone H3.2 [Triticum dicoccoides] >XP_037459862.1 histone H3.2 [Triticum dicoccoides] >XP_037459914.1 histone H3.2 [Triticum dicoccoides] >XP_037460033.1 histone H3.2 [Triticum dicoccoides] >XP_037460058.1 histone H3.2 [Triticum dicoccoides] >XP_037460123.1 histone H3.2 [Triticum dicoccoides] >XP_037460651.1 histone H3.2 [Triticum dicoccoides] >XP_037463316.1 histone H3.2 [Triticum dicoccoides] >XP_037468554.1 histone H3.2 [Triticum dicoccoides] >XP_037468604.1 histone H3.2 [Triticum dicoccoides] >XP_037468697.1 histone H3.2 [Triticum dicoccoides] >XP_037468876.1 histone H3.2 [Triticum dicoccoides] >XP_037468935.1 histone H3.2 [Triticum dicoccoides] >XP_037468950.1 histone H3.2 [Triticum dicoccoides] >XP_037470042.1 histone H3.2 [Triticum dicoccoides] >XP_037470170.1 histone H3.2 [Triticum dicoccoides] >XP_037471314.1 histone H3.2 [Triticum dicoccoides] >XP_037471532.1 histone H3.2 [Triticum dicoccoides] >XP_037472458.1 histone H3.2 [Triticum dicoccoides] >XP_037473143.1 histone H3.2 [Triticum dicoccoides] >XP_037473145.1 histone H3.2 [Triticum dicoccoides] >XP_037473146.1 histone H3.2 [Triticum dicoccoides] >XP_037473152.1 histone H3.2 [Triticum dicoccoides] >XP_037473165.1 histone H3.2 [Triticum dicoccoides] >XP_037473166.1 histone H3.2 [Triticum dicoccoides] >XP_037473168.1 histone H3.2 [Triticum dicoccoides] >XP_037473169.1 histone H3.2 [Triticum dicoccoides] >XP_037478597.1 histone H3.2 [Triticum dicoccoides] >XP_037484075.1 histone H3.2 [Triticum dicoccoides] >XP_037485601.1 histone H3.2 [Triticum dicoccoides] >XP_038885281.1 histone H3.2 isoform X1 [Benincasa hispida] >XP_038885282.1 histone H3.2 isoform X2 [Benincasa hispida] >XP_038886738.1 histone H3.2 [Benincasa hispida] >XP_038901636.1 histone H3.2 [Benincasa hispida] >XP_039683721.1 histone H3.2 [Medicago truncatula] >XP_040991743.1 histone H3.2 [Juglans microcarpa x Juglans regia] >XP_040994678.1 histone H3.2 [Juglans microcarpa x Juglans regia] >XP_040995179.1 histone H3.2 [Juglans microcarpa x Juglans regia] >XP_042477981.1 histone H3.2 [Macadamia integrifolia] >XP_042479098.1 histone H3.2 [Macadamia integrifolia] >XP_042483801.1 histone H3.2 [Macadamia integrifolia] >XP_042493271.1 histone H3.2 [Macadamia integrifolia] >XP_042493272.1 histone H3.2 [Macadamia integrifolia] >XP_042493632.1 histone H3.2 [Macadamia integrifolia] >XP_042504150.1 histone H3.2 [Macadamia integrifolia] >XP_042506691.1 histone H3.2 [Macadamia integrifolia] >XP_042509436.1 histone H3.2 [Macadamia integrifolia] >XP_042516255.1 histone H3.2 [Macadamia integrifolia] >XP_042958477.1 histone H3.2 [Carya illinoinensis] >P68427.2 RecName: Full=Histone H3.2 [Pisum sativum] >P68428.2 RecName: Full=Histone H3.2 [Triticum aestivum] >P68429.2 RecName: Full=Histone H3.2; AltName: Full=Histone H3.1; AltName: Full=Major histone H3 [Medicago sativa] >P68430.2 RecName: Full=Histone H3.2 [Onobrychis viciifolia] >ACZ74621.1 histone H3-like protein [Wolffia arrhiza] >ADE76568.1 unknown [Picea sitchensis] >AFK42592.1 unknown [Lotus japonicus] >KAA0063165.1 histone H3.2 [Cucumis melo var. makuwa] >KAB2604086.1 hypothetical protein D8674_039036 [Pyrus ussuriensis x Pyrus communis] >KAE8768443.1 histone H3.2 [Hordeum vulgare] >KAE9463240.1 hypothetical protein C3L33_04855, partial [Rhododendron williamsianum] >KAE9585970.1 putative transcription factor Hap3/NF-YB family [Lupinus albus] >KAF3958434.1 hypothetical protein CMV_016671 [Castanea mollissima] >KAF8404419.1 hypothetical protein HHK36_009304 [Tetracentron sinense] >KAF9835302.1 hypothetical protein H0E87_031658 [Populus deltoides] >KAG0488009.1 hypothetical protein HPP92_006820 [Vanilla planifolia] >KAG5566233.1 hypothetical protein RHGRI_001991 [Rhododendron griersonianum] >KAG6575675.1 hypothetical protein SDJN03_26314, partial [Cucurbita argyrosperma subsp. sororia] >KAG6774676.1 hypothetical protein POTOM_022038 [Populus tomentosa] >KAG7014227.1 hypothetical protein SDJN02_24402, partial [Cucurbita argyrosperma subsp. argyrosperma] >KAG8064450.1 hypothetical protein GUJ93_ZPchr0004g40150 [Zizania palustris] >MQL75565.1 hypothetical protein [Colocasia esculenta] >NMR96671.1 histone H3 [Vibrio parahaemolyticus] >PNX56033.1 histone H3-like protein [Trifolium pratense] >RDX95602.1 hypothetical protein CR513_21849, partial [Mucuna pruriens] >TKY45766.1 histone H3.2 [Spatholobus suberectus] >TQD89836.1 hypothetical protein C1H46_024602 [Malus baccata] >CAA7400274.1 unnamed protein product [Spirodela intermedia] >VAH07517.1 unnamed protein product [Triticum turgidum subsp. durum] >BAJ85119.1 predicted protein [Hordeum vulgare subsp. vulgare] >BAT73288.1 hypothetical protein VIGAN_01076100 [Vigna angularis var. angularis] >GAU14118.1 hypothetical protein TSUD_169430 [Trifolium subterraneum] >GER55089.1 histone H3 [Striga asiatica]) HSP 1 Score: 254 bits (649), Expect = 6.37e-85 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. NCBI nr
Match: KYP58465.1 (Histone H3.2, partial [Cajanus cajan]) HSP 1 Score: 254 bits (649), Expect = 7.29e-85 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. NCBI nr
Match: KAG5038486.1 (hypothetical protein JHK86_019326 [Glycine max]) HSP 1 Score: 254 bits (649), Expect = 8.34e-85 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. NCBI nr
Match: XP_037450459.1 (histone H3.2-like [Triticum dicoccoides]) HSP 1 Score: 254 bits (648), Expect = 9.05e-85 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. NCBI nr
Match: KAF7050025.1 (hypothetical protein CFC21_058446 [Triticum aestivum]) HSP 1 Score: 254 bits (648), Expect = 9.05e-85 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy TrEMBL
Match: A0A371GYI7 (Histone H3 (Fragment) OS=Mucuna pruriens OX=157652 GN=CR513_21849 PE=3 SV=1) HSP 1 Score: 254 bits (649), Expect = 3.09e-85 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy TrEMBL
Match: A0A7I8KTE6 (Histone H3 OS=Spirodela intermedia OX=51605 GN=SI8410_08010952 PE=3 SV=1) HSP 1 Score: 254 bits (649), Expect = 3.09e-85 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy TrEMBL
Match: A0A1S3TJX1 (Histone H3 OS=Vigna radiata var. radiata OX=3916 GN=LOC106756235 PE=3 SV=1) HSP 1 Score: 254 bits (649), Expect = 3.09e-85 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy TrEMBL
Match: A0A6J1JNA9 (Histone H3 OS=Cucurbita maxima OX=3661 GN=LOC111488429 PE=3 SV=1) HSP 1 Score: 254 bits (649), Expect = 3.09e-85 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. ExPASy TrEMBL
Match: I1HK57 (Histone H3 OS=Brachypodium distachyon OX=15368 GN=100825800 PE=3 SV=1) HSP 1 Score: 254 bits (649), Expect = 3.09e-85 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. TAIR 10
Match: AT1G09200.1 (Histone superfamily protein ) HSP 1 Score: 252.3 bits (643), Expect = 2.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. TAIR 10
Match: AT3G27360.1 (Histone superfamily protein ) HSP 1 Score: 252.3 bits (643), Expect = 2.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. TAIR 10
Match: AT5G10390.1 (Histone superfamily protein ) HSP 1 Score: 252.3 bits (643), Expect = 2.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. TAIR 10
Match: AT5G10400.1 (Histone superfamily protein ) HSP 1 Score: 252.3 bits (643), Expect = 2.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG12g07010 vs. TAIR 10
Match: AT5G65360.1 (Histone superfamily protein ) HSP 1 Score: 252.3 bits (643), Expect = 2.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|