Cp4.1LG11g05620 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGGGGGTTTGGGTTTTCAAGAACGGTGTAATTCGACTGATCGAAAATCCTCAAGCTGATTCTGATGGAAGGCTTGGGAACTCGAGACGAAAGGTACTGATATACTTGCCGACAGGCCAGGCTGTGTCGTCCTACTCCTTGCTACAGGAAATCCTCACATCGTTGGGATGGGAGAGGTACTATGGAGGTGATCCAGAGCTGTTTCAGTTTCATAAACGCTCGTCTATTGACCTTATTTCTCTACCCAAAGACTATGCCAAGTTTAACTCCGTTCATATGTACGACATAGTCATTAAAAACCCTAATCTCTTCCACGTTCGAGATGTGTGA ATGTCGGGGGTTTGGGTTTTCAAGAACGGTGTAATTCGACTGATCGAAAATCCTCAAGCTGATTCTGATGGAAGGCTTGGGAACTCGAGACGAAAGGTACTGATATACTTGCCGACAGGCCAGGCTGTGTCGTCCTACTCCTTGCTACAGGAAATCCTCACATCGTTGGGATGGGAGAGGTACTATGGAGGTGATCCAGAGCTGTTTCAGTTTCATAAACGCTCGTCTATTGACCTTATTTCTCTACCCAAAGACTATGCCAAGTTTAACTCCGTTCATATGTACGACATAGTCATTAAAAACCCTAATCTCTTCCACGTTCGAGATGTGTGA ATGTCGGGGGTTTGGGTTTTCAAGAACGGTGTAATTCGACTGATCGAAAATCCTCAAGCTGATTCTGATGGAAGGCTTGGGAACTCGAGACGAAAGGTACTGATATACTTGCCGACAGGCCAGGCTGTGTCGTCCTACTCCTTGCTACAGGAAATCCTCACATCGTTGGGATGGGAGAGGTACTATGGAGGTGATCCAGAGCTGTTTCAGTTTCATAAACGCTCGTCTATTGACCTTATTTCTCTACCCAAAGACTATGCCAAGTTTAACTCCGTTCATATGTACGACATAGTCATTAAAAACCCTAATCTCTTCCACGTTCGAGATGTGTGA MSGVWVFKNGVIRLIENPQADSDGRLGNSRRKVLIYLPTGQAVSSYSLLQEILTSLGWERYYGGDPELFQFHKRSSIDLISLPKDYAKFNSVHMYDIVIKNPNLFHVRDV Homology
BLAST of Cp4.1LG11g05620 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 5.7e-42 Identity = 81/110 (73.64%), Postives = 95/110 (86.36%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 1.7e-41 Identity = 82/111 (73.87%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy Swiss-Prot
Match: Q9LXB5 (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 3.7e-41 Identity = 78/110 (70.91%), Postives = 93/110 (84.55%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 153.3 bits (386), Expect = 1.6e-36 Identity = 75/124 (60.48%), Postives = 93/124 (75.00%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy Swiss-Prot
Match: Q9LGE3 (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAA1 PE=1 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 3.3e-34 Identity = 68/109 (62.39%), Postives = 84/109 (77.06%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. NCBI nr
Match: XP_023546289.1 (flowering-promoting factor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 226 bits (576), Expect = 1.26e-74 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. NCBI nr
Match: XP_022997475.1 (flowering-promoting factor 1-like [Cucurbita maxima]) HSP 1 Score: 224 bits (571), Expect = 7.31e-74 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. NCBI nr
Match: XP_022961815.1 (flowering-promoting factor 1-like [Cucurbita moschata] >KAG6598816.1 Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7029756.1 Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 222 bits (566), Expect = 4.24e-73 Identity = 108/110 (98.18%), Postives = 109/110 (99.09%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. NCBI nr
Match: XP_022950996.1 (flowering-promoting factor 1-like protein 2 [Cucurbita moschata] >XP_023002558.1 flowering-promoting factor 1-like protein 2 [Cucurbita maxima] >XP_023536838.1 flowering-promoting factor 1-like protein 2 [Cucurbita pepo subsp. pepo] >XP_023536839.1 flowering-promoting factor 1-like protein 2 [Cucurbita pepo subsp. pepo] >KAG6585419.1 Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7020339.1 Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 219 bits (559), Expect = 4.96e-72 Identity = 105/110 (95.45%), Postives = 109/110 (99.09%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. NCBI nr
Match: XP_022132061.1 (flowering-promoting factor 1-like [Momordica charantia]) HSP 1 Score: 212 bits (540), Expect = 3.93e-69 Identity = 100/110 (90.91%), Postives = 108/110 (98.18%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy TrEMBL
Match: A0A6J1K9R7 (flowering-promoting factor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111492382 PE=3 SV=1) HSP 1 Score: 224 bits (571), Expect = 3.54e-74 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy TrEMBL
Match: A0A6J1HDA8 (flowering-promoting factor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111462464 PE=3 SV=1) HSP 1 Score: 222 bits (566), Expect = 2.05e-73 Identity = 108/110 (98.18%), Postives = 109/110 (99.09%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy TrEMBL
Match: A0A6J1KTX8 (flowering-promoting factor 1-like protein 2 OS=Cucurbita maxima OX=3661 GN=LOC111496368 PE=3 SV=1) HSP 1 Score: 219 bits (559), Expect = 2.40e-72 Identity = 105/110 (95.45%), Postives = 109/110 (99.09%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy TrEMBL
Match: A0A6J1GGC5 (flowering-promoting factor 1-like protein 2 OS=Cucurbita moschata OX=3662 GN=LOC111453973 PE=3 SV=1) HSP 1 Score: 219 bits (559), Expect = 2.40e-72 Identity = 105/110 (95.45%), Postives = 109/110 (99.09%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. ExPASy TrEMBL
Match: A0A6J1BR67 (flowering-promoting factor 1-like OS=Momordica charantia OX=3673 GN=LOC111005023 PE=3 SV=1) HSP 1 Score: 212 bits (540), Expect = 1.90e-69 Identity = 100/110 (90.91%), Postives = 108/110 (98.18%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 169.9 bits (429), Expect = 1.2e-42 Identity = 82/111 (73.87%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 168.7 bits (426), Expect = 2.6e-42 Identity = 78/110 (70.91%), Postives = 93/110 (84.55%), Query Frame = 0
BLAST of Cp4.1LG11g05620 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 153.3 bits (386), Expect = 1.1e-37 Identity = 75/124 (60.48%), Postives = 93/124 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|