
Cp4.1LG10g04540 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCGGAACCAGTGAGTGCCAAGCGGTAGTTTGTGCAGGAAATGTAAATGCAATTTGTCCACCGGAATTAGCCGTCAGAGGACAAGATGGTGCAGTGATCGCGTGTAAAAGTGCTTGTATGGCTTTCAATCAGCCGGAATTTTGTTGCTGCGGCAACCACAATCAGCCACAAACTTGCCCGCCGACGAACTATTCGAAGATGTTCAAGGATCAATGTCCCCAGGCTTATAGTTACGCTTACGATGATCAAACAAGTATCTTTACGTGCACGGCCGGAGCCAATTATGGCATCACTTTTTGTCCTTGA ATGGGCGGAACCAGTGAGTGCCAAGCGGTAGTTTGTGCAGGAAATGTAAATGCAATTTGTCCACCGGAATTAGCCGTCAGAGGACAAGATGGTGCAGTGATCGCGTGTAAAAGTGCTTGTATGGCTTTCAATCAGCCGGAATTTTGTTGCTGCGGCAACCACAATCAGCCACAAACTTGCCCGCCGACGAACTATTCGAAGATGTTCAAGGATCAATGTCCCCAGGCTTATAGTTACGCTTACGATGATCAAACAAGTATCTTTACGTGCACGGCCGGAGCCAATTATGGCATCACTTTTTGTCCTTGA ATGGGCGGAACCAGTGAGTGCCAAGCGGTAGTTTGTGCAGGAAATGTAAATGCAATTTGTCCACCGGAATTAGCCGTCAGAGGACAAGATGGTGCAGTGATCGCGTGTAAAAGTGCTTGTATGGCTTTCAATCAGCCGGAATTTTGTTGCTGCGGCAACCACAATCAGCCACAAACTTGCCCGCCGACGAACTATTCGAAGATGTTCAAGGATCAATGTCCCCAGGCTTATAGTTACGCTTACGATGATCAAACAAGTATCTTTACGTGCACGGCCGGAGCCAATTATGGCATCACTTTTTGTCCTTGA MGGTSECQAVVCAGNVNAICPPELAVRGQDGAVIACKSACMAFNQPEFCCCGNHNQPQTCPPTNYSKMFKDQCPQAYSYAYDDQTSIFTCTAGANYGITFCP Homology
BLAST of Cp4.1LG10g04540 vs. ExPASy Swiss-Prot
Match: O80327 (Thaumatin-like protein 1 OS=Pyrus pyrifolia OX=3767 GN=TL1 PE=1 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.5e-36 Identity = 62/101 (61.39%), Postives = 80/101 (79.21%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy Swiss-Prot
Match: Q9SMH2 (Thaumatin-like protein 1 OS=Castanea sativa OX=21020 GN=TL1 PE=2 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 3.7e-35 Identity = 63/101 (62.38%), Postives = 77/101 (76.24%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy Swiss-Prot
Match: P83332 (Thaumatin-like protein 1 OS=Prunus persica OX=3760 PE=2 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.8e-34 Identity = 61/101 (60.40%), Postives = 80/101 (79.21%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy Swiss-Prot
Match: P50694 (Glucan endo-1,3-beta-glucosidase OS=Prunus avium OX=42229 PE=1 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.4e-33 Identity = 58/101 (57.43%), Postives = 72/101 (71.29%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy Swiss-Prot
Match: Q9FSG7 (Thaumatin-like protein 1a OS=Malus domestica OX=3750 GN=TL1 PE=1 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.3e-32 Identity = 59/101 (58.42%), Postives = 75/101 (74.26%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: XP_023545182.1 (thaumatin-like protein 1b [Cucurbita pepo subsp. pepo]) HSP 1 Score: 227 bits (578), Expect = 3.66e-73 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: XP_022925800.1 (thaumatin-like protein 1b [Cucurbita moschata]) HSP 1 Score: 219 bits (557), Expect = 5.69e-70 Identity = 98/102 (96.08%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: XP_022977264.1 (thaumatin-like protein 1, partial [Cucurbita maxima]) HSP 1 Score: 195 bits (495), Expect = 1.63e-61 Identity = 89/102 (87.25%), Postives = 93/102 (91.18%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: XP_022143966.1 (thaumatin-like protein 1b [Momordica charantia]) HSP 1 Score: 187 bits (474), Expect = 2.27e-57 Identity = 79/102 (77.45%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: XP_023518535.1 (thaumatin-like protein 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 184 bits (468), Expect = 1.79e-56 Identity = 76/102 (74.51%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy TrEMBL
Match: A0A6J1EJ83 (thaumatin-like protein 1b OS=Cucurbita moschata OX=3662 GN=LOC111433101 PE=3 SV=1) HSP 1 Score: 219 bits (557), Expect = 2.75e-70 Identity = 98/102 (96.08%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy TrEMBL
Match: A0A6J1IQX5 (thaumatin-like protein 1 OS=Cucurbita maxima OX=3661 GN=LOC111477632 PE=3 SV=1) HSP 1 Score: 195 bits (495), Expect = 7.92e-62 Identity = 89/102 (87.25%), Postives = 93/102 (91.18%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy TrEMBL
Match: A0A6J1CRW2 (thaumatin-like protein 1b OS=Momordica charantia OX=3673 GN=LOC111013752 PE=3 SV=1) HSP 1 Score: 187 bits (474), Expect = 1.10e-57 Identity = 79/102 (77.45%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy TrEMBL
Match: A0A6J1HDP6 (thaumatin-like protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111463218 PE=3 SV=1) HSP 1 Score: 184 bits (467), Expect = 1.23e-56 Identity = 76/101 (75.25%), Postives = 91/101 (90.10%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. ExPASy TrEMBL
Match: A0A6J1ICJ7 (thaumatin-like protein 1 OS=Cucurbita maxima OX=3661 GN=LOC111471284 PE=3 SV=1) HSP 1 Score: 184 bits (466), Expect = 1.74e-56 Identity = 76/102 (74.51%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. TAIR 10
Match: AT1G19320.1 (Pathogenesis-related thaumatin superfamily protein ) HSP 1 Score: 136.3 bits (342), Expect = 1.3e-32 Identity = 63/100 (63.00%), Postives = 74/100 (74.00%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. TAIR 10
Match: AT1G75030.1 (thaumatin-like protein 3 ) HSP 1 Score: 130.2 bits (326), Expect = 9.6e-31 Identity = 61/102 (59.80%), Postives = 70/102 (68.63%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. TAIR 10
Match: AT1G75040.1 (pathogenesis-related gene 5 ) HSP 1 Score: 129.4 bits (324), Expect = 1.6e-30 Identity = 58/101 (57.43%), Postives = 76/101 (75.25%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. TAIR 10
Match: AT1G75050.1 (Pathogenesis-related thaumatin superfamily protein ) HSP 1 Score: 129.4 bits (324), Expect = 1.6e-30 Identity = 61/102 (59.80%), Postives = 70/102 (68.63%), Query Frame = 0
BLAST of Cp4.1LG10g04540 vs. TAIR 10
Match: AT1G73620.1 (Pathogenesis-related thaumatin superfamily protein ) HSP 1 Score: 123.2 bits (308), Expect = 1.2e-28 Identity = 58/101 (57.43%), Postives = 70/101 (69.31%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|