Cp4.1LG07g09770 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGATGGAGAAGAAGCCGCACGGCGTCATTCCGCTCTCAATGACTACCGCAAGAAGCTCCTTCAGCACAAAGAACTCGACGCTAGAGTCCGATCTCGTATATCCCTCCCTTTACAATCTATGCTCCTCTTCTTTACTTTTCTCAATTCTGCTACTAGACGACTCGATGCTTCTTTGCTCATTTCAGTAATTGTTGTAGTCTTTCAATCTTCTGCAATGGTTTCGTTCCGTAGAATTTGAATGGCGGATGGAGAAGAAGCCGCACGGCGTCATTCCGCTCTCAATGACTACCGCAAGAAGCTCCTTCAGCACAAAGAACTCGACGCTAGAGTCCGATCTCGTATATCCCTCCCTTTACAATCTATGCTCCTCTTCTTTACTTTTCTCAATTCTGCTACTAGACGACTCGATGCTTCTTTGCTCATTTCAGTAATTGTTGTAGTCTTTCAATCTTCTGCAATGGTTTCGTTCCGTAGAATTTGA ATGGCGGATGGAGAAGAAGCCGCACGGCGTCATTCCGCTCTCAATGACTACCGCAAGAAGCTCCTTCAGCACAAAGAACTCGACGCTAGAGTCCGATCTCGTATATCCCTCCCTTTACAATCTATGCTCCTCTTCTTTACTTTTCTCAATTCTGCTACTAGACGACTCGATGCTTCTTTGCTCATTTCAGTAATTGTTGTAGTCTTTCAATCTTCTGCAATGGTTTCGTTCCGTAGAATTTGA MADGEEAARRHSALNDYRKKLLQHKELDARVRSRISLPLQSMLLFFTFLNSATRRLDASLLISVIVVVFQSSAMVSFRRI Homology
BLAST of Cp4.1LG07g09770 vs. ExPASy Swiss-Prot
Match: Q9MAK9 (26S proteasome regulatory subunit S10B homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT4B PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 2.6e-04 Identity = 22/34 (64.71%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. NCBI nr
Match: XP_022965782.1 (26S proteasome regulatory subunit S10B homolog B-like [Cucurbita maxima]) HSP 1 Score: 67.0 bits (162), Expect = 1.06e-10 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. NCBI nr
Match: XP_022937895.1 (26S proteasome regulatory subunit S10B homolog B-like isoform X2 [Cucurbita moschata] >XP_022937897.1 26S proteasome regulatory subunit S10B homolog B-like isoform X2 [Cucurbita moschata] >XP_023538524.1 26S proteasome regulatory subunit S10B homolog B isoform X2 [Cucurbita pepo subsp. pepo] >XP_023538592.1 26S proteasome regulatory subunit S10B homolog B isoform X2 [Cucurbita pepo subsp. pepo] >KAG6586322.1 26S proteasome regulatory subunit S10B-like B, partial [Cucurbita argyrosperma subsp. sororia] >KAG7021172.1 26S protease regulatory subunit S10B-like B [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 67.0 bits (162), Expect = 1.06e-10 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. NCBI nr
Match: XP_022965751.1 (26S proteasome regulatory subunit S10B homolog B-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 67.0 bits (162), Expect = 1.06e-10 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. NCBI nr
Match: XP_022937894.1 (26S proteasome regulatory subunit S10B homolog B-like isoform X1 [Cucurbita moschata] >XP_022937896.1 26S proteasome regulatory subunit S10B homolog B-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 67.0 bits (162), Expect = 1.10e-10 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. NCBI nr
Match: XP_022965750.1 (26S proteasome regulatory subunit S10B homolog B-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 67.0 bits (162), Expect = 1.10e-10 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. ExPASy TrEMBL
Match: A0A6J1FCH3 (26S proteasome regulatory subunit S10B homolog B-like isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111444150 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.15e-11 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. ExPASy TrEMBL
Match: A0A6J1HL87 (26S proteasome regulatory subunit S10B homolog B-like OS=Cucurbita maxima OX=3661 GN=LOC111465571 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.15e-11 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. ExPASy TrEMBL
Match: A0A6J1HMI9 (26S proteasome regulatory subunit S10B homolog B-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111465550 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.15e-11 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. ExPASy TrEMBL
Match: A0A6J1FBM9 (26S proteasome regulatory subunit S10B homolog B-like isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111444150 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.32e-11 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. ExPASy TrEMBL
Match: A0A6J1HPL8 (26S proteasome regulatory subunit S10B homolog B-like isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111465550 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.32e-11 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. TAIR 10
Match: AT1G45000.1 (AAA-type ATPase family protein ) HSP 1 Score: 45.8 bits (107), Expect = 1.9e-05 Identity = 22/34 (64.71%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. TAIR 10
Match: AT1G45000.2 (AAA-type ATPase family protein ) HSP 1 Score: 45.8 bits (107), Expect = 1.9e-05 Identity = 22/34 (64.71%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Cp4.1LG07g09770 vs. TAIR 10
Match: AT5G43010.1 (regulatory particle triple-A ATPase 4A ) HSP 1 Score: 41.2 bits (95), Expect = 4.6e-04 Identity = 20/34 (58.82%), Postives = 29/34 (85.29%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|