Cp4.1LG05g01020 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGGAGTTTCAGAGCCTAAGGCAGAGGATGATGACCGAGTACAAGGAAACGGTCTGGCAAAGATACTTCACGGTGACAGGAGAGCACCCGAATGAGGAGGTGACAGAGAAGATAATATTGAGTGGCATGGGAGGAGTTTTTGGGGAGGGCGATAGAGGAACACGGGCAGGGAAAGGTGGCAGAGACGATGAAGGAGATACAGGTCCGACACGGGGTGGTGAAGGAGATAGAGAAGCGCTTGCTAGAGCTGCACAAAGAGTTTTTGGACATGGCAGTGATGGCGGAGGCACAAGGGCAGGAAATGGATAA ATGATGGAGTTTCAGAGCCTAAGGCAGAGGATGATGACCGAGTACAAGGAAACGGTCTGGCAAAGATACTTCACGGTGACAGGAGAGCACCCGAATGAGGAGGTGACAGAGAAGATAATATTGAGTGGCATGGGAGGAGTTTTTGGGGAGGGCGATAGAGGAACACGGGCAGGGAAAGGTGGCAGAGACGATGAAGGAGATACAGGTCCGACACGGGGTGGTGAAGGAGATAGAGAAGCGCTTGCTAGAGCTGCACAAAGAGTTTTTGGACATGGCAGTGATGGCGGAGGCACAAGGGCAGGAAATGGATAA ATGATGGAGTTTCAGAGCCTAAGGCAGAGGATGATGACCGAGTACAAGGAAACGGTCTGGCAAAGATACTTCACGGTGACAGGAGAGCACCCGAATGAGGAGGTGACAGAGAAGATAATATTGAGTGGCATGGGAGGAGTTTTTGGGGAGGGCGATAGAGGAACACGGGCAGGGAAAGGTGGCAGAGACGATGAAGGAGATACAGGTCCGACACGGGGTGGTGAAGGAGATAGAGAAGCGCTTGCTAGAGCTGCACAAAGAGTTTTTGGACATGGCAGTGATGGCGGAGGCACAAGGGCAGGAAATGGATAA MMEFQSLRQRMMTEYKETVWQRYFTVTGEHPNEEVTEKIILSGMGGVFGEGDRGTRAGKGGRDDEGDTGPTRGGEGDREALARAAQRVFGHGSDGGGTRAGNG Homology
BLAST of Cp4.1LG05g01020 vs. ExPASy Swiss-Prot
Match: Q42374 (Syntaxin-related protein KNOLLE OS=Arabidopsis thaliana OX=3702 GN=KN PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.9e-11 Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy Swiss-Prot
Match: Q9ZQZ8 (Syntaxin-123 OS=Arabidopsis thaliana OX=3702 GN=SYP123 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 7.3e-07 Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy Swiss-Prot
Match: O64791 (Syntaxin-124 OS=Arabidopsis thaliana OX=3702 GN=SYP124 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 1.0e-05 Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy Swiss-Prot
Match: Q9SXB0 (Syntaxin-125 OS=Arabidopsis thaliana OX=3702 GN=SYP125 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 2.3e-05 Identity = 24/43 (55.81%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy Swiss-Prot
Match: Q9ZSD4 (Syntaxin-121 OS=Arabidopsis thaliana OX=3702 GN=SYP121 PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.5e-04 Identity = 21/43 (48.84%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. NCBI nr
Match: KAG7036293.1 (Syntaxin-related protein KNOLLE, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 90.1 bits (222), Expect = 7.55e-21 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. NCBI nr
Match: KAG6606350.1 (Syntaxin-related protein KNOLLE, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 90.1 bits (222), Expect = 8.43e-21 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. NCBI nr
Match: RVW90044.1 (Syntaxin-related protein KNOLLE [Vitis vinifera]) HSP 1 Score: 86.7 bits (213), Expect = 2.29e-18 Identity = 55/99 (55.56%), Postives = 65/99 (65.66%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. NCBI nr
Match: KAG6603495.1 (Syntaxin-related protein KNOLLE, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 83.6 bits (205), Expect = 1.53e-16 Identity = 43/56 (76.79%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. NCBI nr
Match: CAB4285906.1 (unnamed protein product [Prunus armeniaca]) HSP 1 Score: 77.8 bits (190), Expect = 7.64e-15 Identity = 50/85 (58.82%), Postives = 55/85 (64.71%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy TrEMBL
Match: A0A438HZZ6 (Syntaxin-related protein KNOLLE OS=Vitis vinifera OX=29760 GN=KN_1 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.11e-18 Identity = 55/99 (55.56%), Postives = 65/99 (65.66%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy TrEMBL
Match: A0A6J5VA26 (SynN domain-containing protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS41990 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 3.70e-15 Identity = 50/85 (58.82%), Postives = 55/85 (64.71%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy TrEMBL
Match: M1BCA9 (Knolle OS=Solanum tuberosum OX=4113 GN=102589897 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 5.25e-14 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy TrEMBL
Match: A0A1S4ASS4 (syntaxin-related protein KNOLLE-like OS=Nicotiana tabacum OX=4097 GN=LOC107800892 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 5.25e-14 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. ExPASy TrEMBL
Match: A0A314LA81 (Syntaxin-related protein knolle OS=Nicotiana attenuata OX=49451 GN=KN PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 5.25e-14 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. TAIR 10
Match: AT1G08560.1 (syntaxin of plants 111 ) HSP 1 Score: 68.6 bits (166), Expect = 3.4e-12 Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. TAIR 10
Match: AT4G03330.1 (syntaxin of plants 123 ) HSP 1 Score: 54.7 bits (130), Expect = 5.2e-08 Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. TAIR 10
Match: AT1G61290.1 (syntaxin of plants 124 ) HSP 1 Score: 50.8 bits (120), Expect = 7.4e-07 Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. TAIR 10
Match: AT1G11250.1 (syntaxin of plants 125 ) HSP 1 Score: 49.7 bits (117), Expect = 1.7e-06 Identity = 24/43 (55.81%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of Cp4.1LG05g01020 vs. TAIR 10
Match: AT3G11820.2 (syntaxin of plants 121 ) HSP 1 Score: 47.0 bits (110), Expect = 1.1e-05 Identity = 21/43 (48.84%), Postives = 32/43 (74.42%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|