CmoCh04G014080 (gene) Cucurbita moschata (Rifu) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAAGTCTTGCAAAGGTTTAGCGATGGAACTGGTCAAGTGTCTCAGCGAATCCGATTGTGTAAAGGTCTTGTATAATCATCTTCTCTCTGTATTTGTCTGTCTTTATGTGTGTGCGTGTGCAGACATGTATCTTATCAGTACTTGGATAATCTTACTATAGAATTGCCATCTATTATTCTTAAATGTCCTTTTTACTCTTTGGCTATCATTTGTGACAGATTATACAGTATTAATGAATGTTAGAACAGTCTATCACGAATAATGTAAATAAGGATGTATAGCGTCGTTGCTTGATTTCAACATGGATTTCAGTCTTTATGTTGTTGTAATTTCAGGTCCAGAACCGAACTTACAAGGAATGTGCTGGAGAGAAGAGTCCTTGCATTCCTAGCGAATGCGTGGGATTAAGGGAAACATATTTCAATTGTAAAAGAGGCCAGGCAAGTTATCGTGAACTCCTTCTCTAGATGTCGAAGTCTTGCAAAGGTTTAGCGATGGAACTGGTCAAGTGTCTCAGCGAATCCGATTGTGTAAAGGTCTTGTATAATCATCTTCTCTCTGTATTTGTCTGTCTTTATGTGTGTGCGTGTGCAGACATGTATCTTATCAATTATACAGTATTAATGAATGTCCAGAACCGAACTTACAAGGAATGTGCTGGAGAGAAGAGTCCTTGCATTCCTAGCGAATGCGTGGGATTAAGGGAAACATATTTCAATTGTAAAAGAGGCCAGGCAAGTTATCGTGAACTCCTTCTCTAG ATGTCGAAGTCTTGCAAAGGTTTAGCGATGGAACTGGTCAAGTGTCTCAGCGAATCCGATTGTGTAAAGGTCTTGTATAATCATCTTCTCTCTGTATTTGTCTGTCTTTATGTGTGTGCGTGTGCAGACATGTATCTTATCAATTATACAGTATTAATGAATGTCCAGAACCGAACTTACAAGGAATGTGCTGGAGAGAAGAGTCCTTGCATTCCTAGCGAATGCGTGGGATTAAGGGAAACATATTTCAATTGTAAAAGAGGCCAGGCAAGTTATCGTGAACTCCTTCTCTAG MSKSCKGLAMELVKCLSESDCVKVLYNHLLSVFVCLYVCACADMYLINYTVLMNVQNRTYKECAGEKSPCIPSECVGLRETYFNCKRGQASYRELLL Homology
BLAST of CmoCh04G014080 vs. ExPASy TrEMBL
Match: A0A6J1IEJ6 (cytochrome c oxidase assembly factor 5 OS=Cucurbita maxima OX=3661 GN=LOC111476521 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 6.0e-22 Identity = 59/93 (63.44%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CmoCh04G014080 vs. ExPASy TrEMBL
Match: A0A6J1GYH3 (cytochrome c oxidase assembly factor 5 OS=Cucurbita moschata OX=3662 GN=LOC111458337 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 6.0e-22 Identity = 59/93 (63.44%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CmoCh04G014080 vs. ExPASy TrEMBL
Match: A0A6J1CDL1 (cytochrome c oxidase assembly factor 5 OS=Momordica charantia OX=3673 GN=LOC111010254 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.3e-21 Identity = 58/93 (62.37%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CmoCh04G014080 vs. ExPASy TrEMBL
Match: A0A0A0KRS4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G623760 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.3e-21 Identity = 58/93 (62.37%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CmoCh04G014080 vs. ExPASy TrEMBL
Match: A0A1S3BGA9 (cytochrome c oxidase assembly factor 5 OS=Cucumis melo OX=3656 GN=LOC103489506 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.3e-21 Identity = 58/93 (62.37%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CmoCh04G014080 vs. NCBI nr
Match: KAG7031931.1 (hypothetical protein SDJN02_05973 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 124.4 bits (311), Expect = 5.4e-25 Identity = 65/97 (67.01%), Postives = 66/97 (68.04%), Query Frame = 0
BLAST of CmoCh04G014080 vs. NCBI nr
Match: XP_022956695.1 (cytochrome c oxidase assembly factor 5 [Cucurbita moschata] >XP_022975987.1 cytochrome c oxidase assembly factor 5 [Cucurbita maxima] >XP_023534123.1 cytochrome c oxidase assembly factor 5 [Cucurbita pepo subsp. pepo] >XP_023534138.1 cytochrome c oxidase assembly factor 5 [Cucurbita pepo subsp. pepo] >KAG6601133.1 Cytochrome c oxidase assembly factor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 113.2 bits (282), Expect = 1.2e-21 Identity = 59/93 (63.44%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CmoCh04G014080 vs. NCBI nr
Match: XP_008446948.1 (PREDICTED: cytochrome c oxidase assembly factor 5 [Cucumis melo] >XP_022139307.1 cytochrome c oxidase assembly factor 5 [Momordica charantia] >XP_022139308.1 cytochrome c oxidase assembly factor 5 [Momordica charantia] >XP_031741572.1 cytochrome c oxidase assembly factor 5 [Cucumis sativus] >XP_031741573.1 cytochrome c oxidase assembly factor 5 [Cucumis sativus] >XP_038889422.1 cytochrome c oxidase assembly factor 5 [Benincasa hispida] >KGN52313.1 hypothetical protein Csa_009226 [Cucumis sativus]) HSP 1 Score: 112.1 bits (279), Expect = 2.7e-21 Identity = 58/93 (62.37%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CmoCh04G014080 vs. NCBI nr
Match: ADN34196.1 (hypothetical protein [Cucumis melo subsp. melo]) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-20 Identity = 57/89 (64.04%), Postives = 58/89 (65.17%), Query Frame = 0
BLAST of CmoCh04G014080 vs. NCBI nr
Match: RDX68455.1 (hypothetical protein CR513_52559, partial [Mucuna pruriens]) HSP 1 Score: 109.4 bits (272), Expect = 1.8e-20 Identity = 55/92 (59.78%), Postives = 60/92 (65.22%), Query Frame = 0
BLAST of CmoCh04G014080 vs. TAIR 10
Match: AT1G10865.1 (FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Cytochrome c oxidase assembly protein PET191, N-terminal (InterPro:IPR018793); Has 241 Blast hits to 241 proteins in 124 species: Archae - 0; Bacteria - 0; Metazoa - 100; Fungi - 94; Plants - 38; Viruses - 0; Other Eukaryotes - 9 (source: NCBI BLink). ) HSP 1 Score: 91.3 bits (225), Expect = 4.7e-19 Identity = 48/93 (51.61%), Postives = 53/93 (56.99%), Query Frame = 0
BLAST of CmoCh04G014080 vs. TAIR 10
Match: AT1G10865.2 (FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Cytochrome c oxidase assembly protein PET191, N-terminal (InterPro:IPR018793); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 89.4 bits (220), Expect = 1.8e-18 Identity = 47/89 (52.81%), Postives = 52/89 (58.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita moschata (Rifu) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|